(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE124

MICSR_1.PE124        Location/Qualifiers
FT   CDS_pept        join(234773..235213,235374..236045)
FT                   /codon_start=1
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636129"
FT                   /orf_name="MICPUN_56697"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61646.1"
FT                   /db_xref="HOGENOM:HBG315851"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A747"
FT                   /db_xref="UniProtKB/TrEMBL:C1E101"
FT                   /transl_table=1
FT                   /translation="MSFGTPGAFGGGGGFGQPAQSPPGAFGAPSPTQPTQVPNPNNDFQ
FT                   VANPPNDGISSLSWSPVANFLVATAWDGDVYCYEVGNNGQAVPKASQKHQGPVLCSDWS
FT                   HDGSAVFSGGCDNKAQKWDLATNTPTQVAQHDAPIKELCWIKEVNLLATGSWDKTLRYW
FT                   DTRQPTPALQVQLPERCYALSCSHPLLVVGTAERHIQVYDLNNPNQPFKQLQSPLKYQT
FT                   RTVAAFPDKSGYLVGSIEGRVAVQHVEDAQQSKNFTFKCHREQSDIYAVNDIKFHPTHG
FT                   TFVTAGADGVFNFWDKDSKQRLKQMAKCNSTIPCGAFNRDGSIYAYAVSYDWSKGGQDP
FT                   MAQSGQNNIFLHAVQESEVKPRPAAVRGRR"
     atgtccttcg gcacgcccgg agcgttcgga gggggcgggg gattcggcca gcccgcgcag        60
     tctcccccgg gggcgttcgg cgccccgtct cccacgcaac cgacgcaggt cccgaacccc       120
     aacaacgatt tccaggtcgc gaacccgccc aacgacggca tctcctcgct gtcgtggtcc       180
     cccgtcgcca acttcctcgt cgccaccgct tgggacggag acgtgtactg ctacgaggtg       240
     gggaacaacg ggcaggcggt gcccaaggct tcgcagaagc atcaaggacc ggtgctgtgc       300
     agcgactggt ctcacgacgg atccgcggtg ttctcggggg gatgcgataa caaggcgcag       360
     aagtgggacc tcgcgaccaa caccccgacg caggtggcgc aacacgacgc ccccatcaag       420
     gagctctgct ggatcaagga ggtcaactta ctcgcgacgg gctcgtggga caagacgctc       480
     cggtactggg acacccgcca gcccacaccc gcgctgcaag tgcaactccc cgagcggtgc       540
     tacgcgctct cgtgctcgca tcccctcctc gtcgtcggca ccgcggagcg acacatccag       600
     gtgtacgacc tcaacaaccc gaaccagccg ttcaagcagc tccagtcccc gctcaagtac       660
     cagacgagaa ccgtggcggc gtttccggac aagagcgggt acctcgtcgg gtccatcgag       720
     ggccgcgtcg ccgtgcagca cgtggaggat gcgcagcagt cgaagaactt cacgttcaag       780
     tgtcaccgcg agcagagcga catctacgcg gtgaacgaca tcaagttcca cccgacgcac       840
     gggacgttcg tcaccgcggg cgcggacggg gtgttcaact tttgggataa ggactcgaag       900
     caacggctga agcagatggc gaagtgcaac tcgaccatcc cgtgcggggc gtttaatcgg       960
     gacgggagca tctacgccta cgcggtgtcc tacgactgga gtaagggtgg gcaggatccc      1020
     atggcgcaga gtgggcagaa taacatcttc ctccacgcgg tgcaggagtc ggaggtgaaa      1080
     ccgaggccag ccgccgtgcg cggaaggcgg tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page