(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE126

MICSR_1.PE126        Location/Qualifiers
FT   CDS_pept        join(239434..239751,239877..240353)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636131"
FT                   /orf_name="MICPUN_56699"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO61647.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG611525"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199A7B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E103"
FT                   /transl_table=1
FT                   /translation="MSVVAASTFAPFSARVRSAIPARSRRASPSSTRRPVATARAEAEA
FT                   EAGGEGSTLSTTPRTAGRRAGLAAGAGLALAAAAFPARAIGGAAVGLPDVVELTPDNFA
FT                   KQVEVPGTTFVEFYAPWCPFCQRLEPIWNELPNRLKEKGVDTKIARMNVDTYVDYGERF
FT                   GVTGFPTLMLFKDGRPVGQKTGLTDMNTLMKYAGYKESGPLAALAGAGAEMNLVLSGEQ
FT                   VQSAADELNELRRMINGEVDGDKASALAHIDAVERLFAKRAL"
     atgagcgtcg tcgccgcatc cacgttcgcg cccttctccg cgcgcgtccg ctcggcgatc        60
     ccggcgaggt cccgccgcgc gtcgccctct tcgacccgcc gccccgtcgc gaccgcgcgc       120
     gccgaggccg aggccgaggc tgggggcgaa gggtcgactt tgtcgacgac gccgcggacg       180
     gcggggcgac gcgcggggct ggcggcgggc gcggggctgg cgctcgccgc ggcggcgttt       240
     cccgcgcgcg cgatcggcgg cgcggcggtg ggtctgcccg acgtcgtcga gctcaccccg       300
     gacaacttcg cgaagcaggt cgaggtcccc gggacgacgt tcgtggagtt ctacgcgccg       360
     tggtgcccct tctgccagag gctggagccc atctggaacg aactgccgaa ccgcctgaag       420
     gaaaagggcg tggacacgaa gatcgcccgg atgaacgtcg acacctacgt cgactacggc       480
     gagcgcttcg gggtgaccgg ctttccgacc ctgatgctgt tcaaggacgg gcgtccggtg       540
     gggcagaaga cgggcttgac ggacatgaac acgctcatga agtacgcggg gtacaaagag       600
     tccgggcccc tcgcggcgct cgcgggcgcc ggcgcagaga tgaacctggt gctcagcggc       660
     gagcaggtgc agtccgcggc ggacgagctg aacgagctgc ggaggatgat aaacggcgag       720
     gtggacgggg ataaggcgtc ggcgctggcg cacatcgacg cggtcgagcg gctgttcgcc       780
     aagcgcgcgc tgtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page