(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE127

MICSR_1.PE127        Location/Qualifiers
FT   CDS_pept        join(complement(242376..242924),complement(240933..242246),
FT                   complement(240489..240821))
FT                   /codon_start=1
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636132"
FT                   /orf_name="MICPUN_80244"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="DNA repair"
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62092.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000199A7B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E104"
FT                   /transl_table=1
FT                   /translation="MLSAVARRASRAAASASSSLGASRVPRRAARDEAARHAIVLTADA
FT                   RRGFASASAHRPTDFDVVVIGGGHAGAEAAAAAARRGARVALVTPSPLGSVGEMSCNPS
FT                   IGGLAKGALVREIDALGGIMGAAADASGIQFRVLNASKGPAVRGPRAQMDRTTYKRSVQ
FT                   AMLFGTPNVEVVDAAAYDLITCAVAGVETADGRKITAEAVVVATGTFLRGVLHVGGRRI
FT                   PAGRMPTAITENPDATAARGAHALADRLYGLGFQMGRLKTGTPPRLDGASIDYSGLEEQ
FT                   RGDEPPRPFGFLHDKAWVPPMKQVSCWATRTNAETERVMKESRGFLNFEGGENGEAIGP
FT                   RYCPSLEMKVKRFPGRSHIVWLEPEGLDTDVVYPNGLSNTLDEPDQIAMLRTVAGLENV
FT                   KMLRPGYGVEYDYVDPRELRWTLETKRVGGLFFAGQINGTTGYEEAAAQGLVAGANAAA
FT                   TALSRLGMDALPPSIVGRGASYLGVLVDDLTRRGTSEPYRMFSSRVEHRLSVRPDNADQ
FT                   RLTAAGELAGLVDSARALIARRRGDATDRAIAALEDARMGAQAWAAHGVDNAPAGKSGR
FT                   TVSAAELLAIPGVGYARVTSALAEAGKTTGESTASGGIDDSRADSATVECYYAPYLARQ
FT                   RRDVETMRKEEAMELPMDLDYDAVGGLSAEDREKLKEFRPATLAAAQRISGVTPSAAIA
FT                   LFRFVAAQKLKGNNKRFSGRRGAVTNGGRDPLMESAL"
     atgctctcgg cggtcgctcg ccgcgcatca cgtgccgctg cgtccgcgtc ctcctccctc        60
     ggcgcatcgc gtgttccgcg gcgagcggcg cgcgacgagg cggcgcgtca cgccatcgtc       120
     ctaaccgccg acgcgcggcg ggggttcgcg tccgcctctg cgcaccgacc caccgacttc       180
     gacgtggtcg tcatcggggg aggccacgcg ggagccgagg ccgccgccgc cgccgcgcgc       240
     cggggcgcgc gcgtcgccct cgtcaccccg tccccgctcg gctccgtcgg cgagatgtcg       300
     tgcaacccgt ccatcggcgg gctcgccaag ggcgcgttgg tccgagagat cgacgcgctg       360
     ggcgggatca tgggcgccgc cgcggacgcg tcggggatcc agttccgggt cctcaacgcg       420
     tccaagggcc ccgccgtccg cggcccgcgc gcgcagatgg acaggacgac gtacaaacga       480
     agcgtccagg cgatgctctt cggcacccca aacgtcgagg ttgtcgacgc cgcggcgtac       540
     gacctcatca cgtgcgcggt ggcgggggtg gagactgcgg atgggcggaa gatcaccgcc       600
     gaggcggtgg tggtcgccac cgggacgttt ctgaggggcg tgttacacgt cggggggcgg       660
     cgcatacccg cggggcgcat gcccaccgcg attaccgaga atcccgacgc caccgcggcg       720
     cgaggggcgc acgcgctggc ggataggctg tacggattgg ggtttcaaat gggcaggctc       780
     aagacgggaa cgccgccgcg actcgacggc gcgtcgattg actactctgg gctcgaggaa       840
     cagcgcggag atgaaccgcc gcgaccgttc gggttcctcc acgacaaagc gtgggtcccg       900
     cccatgaagc aggtgagctg ctgggcgacg cgcacgaacg cggagacgga gagggtgatg       960
     aaggagtcgc ggggtttctt aaatttcgaa ggcggcgaaa acggcgaggc tatcggccct      1020
     cggtactgcc cgtcgctcga gatgaaggtc aagcgctttc ccggccgttc gcacatcgtg      1080
     tggctcgaac ccgagggttt ggacaccgac gtcgtgtacc cgaacgggct ctcgaacacc      1140
     ctggacgagc cggaccagat cgcgatgctc agaaccgtcg cgggtttgga aaacgtcaag      1200
     atgctcagac ccgggtacgg cgtcgagtac gactacgtcg acccgcgcga gctccgatgg      1260
     acgctcgaga cgaagcgcgt cggcggactg ttcttcgccg ggcagatcaa cggcaccacc      1320
     gggtacgagg aggccgcggc gcaggggctg gtggcgggag ccaacgccgc ggcgacggcg      1380
     ctctcgcgcc tcgggatgga cgcgctcccg ccttccatcg tcggccgggg ggcgagctac      1440
     ctcggcgtgc tcgtggacga cctcacgcgc cgaggaacct ccgagcccta ccgcatgttc      1500
     tcgtccaggg tggagcacag gctgtccgtc aggccggaca acgcggacca gaggctgacc      1560
     gccgccggcg agctcgccgg gctggtggac tcggctcgcg ctttaatcgc tcgccgacgg      1620
     ggcgacgcga cggatcgagc catcgcggcg ctggaggacg cgaggatggg cgcgcaggcg      1680
     tgggccgcgc acggggtgga caacgcgccg gcgggtaaga gcgggaggac cgtcagcgcc      1740
     gccgagcttc tcgcgattcc cggcgtggga tacgcccgcg tcacttcggc gctggccgag      1800
     gcggggaaga cgacggggga gtcgacggcg tcgggaggaa tcgacgactc ccgcgccgac      1860
     tcggccacgg tggagtgcta ctacgcgcct tacctggcgc gtcagcggcg ggacgtcgag      1920
     acgatgcgta aggaggaggc gatggagctg ccgatggatc tggactacga cgccgtgggc      1980
     gggctgagcg cggaggacag ggagaagctg aaggagtttc gaccggcgac gctcgcggcg      2040
     gcgcagagga tcagcggggt gaccccgtcg gcggccatcg cgctcttcag gttcgtcgcc      2100
     gcgcaaaaac taaaggggaa taataagagg tttagcggtc gacgcggggc ggtgacaaac      2160
     ggcgggaggg acccgctgat ggaatcggcg ctatag                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page