(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE128

MICSR_1.PE128        Location/Qualifiers
FT   CDS_pept        243095..244198
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636133"
FT                   /orf_name="MICPUN_52141"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61648.1"
FT                   /db_xref="UniParc:UPI000199A7B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E105"
FT                   /transl_table=1
FT                   /translation="MLHSWEKIPRSHTSDPEEVCQLSSPTCHLFEIKFGEVDQIAQSSR
FT                   ALPHPRSAMSLVFASALARPTPAPVAGSRRIAPGAAGKPPRPSASPVVAFAKKKGKGGS
FT                   RDGYDDWDDGFGSGSGNYDANFNSIDDDFYTGAGGDYDSFGSKSGAAKPESGKKKGAAK
FT                   RAKKAKGSDVDDGYAPVAGDVSRLIRSKAPAKPESGAIGSSLDSGDGPNFVRPLDGWKK
FT                   KGEASSYGDVFENSAAFSMDDGDLDFGAEPLAAEPIDAPRVVTVAKAVPKKEKREEAKE
FT                   AKAVDPADPGKGEKKASQTLKKWGFAQSNIDDALGATEEAAATAVGEGQTAYNKRRQVL
FT                   ALDWLLLNAPEDAIPMDYRNDAIKARS"
     atgctccaca gttgggaaaa gatcccgcga agtcacacct ccgatcctga agaagtttgc        60
     cagctcagct cacccacctg ccacctgttc gagataaagt ttggggaggt cgatcagatc       120
     gctcaaagct cacgcgcctt accccacccg cgctccgcga tgtccctcgt gttcgcctcg       180
     gcgctcgcgc gccccacccc ggcgccggtc gccggctccc ggcgcatcgc accgggcgcg       240
     gcgggtaaac ccccccgccc ctccgcctcc cccgtcgtcg ccttcgccaa gaagaaaggc       300
     aagggtggat cgcgcgacgg gtacgacgat tgggacgacg gcttcggcag cggcagcggc       360
     aactacgacg ccaacttcaa ctccatcgac gacgacttct acaccggcgc gggcggcgac       420
     tacgactcct tcggttccaa gtccggcgcc gccaagcccg agagcggcaa gaagaagggc       480
     gccgcgaagc gcgccaagaa ggcaaagggc agcgacgtcg acgacgggta cgcgccggtt       540
     gccggcgacg tctcccggct catccgctcc aaggcgcccg ccaagcccga gagcggcgcc       600
     atcggatcgt ccctagactc cggcgacgga cccaacttcg tgaggccgct cgacggctgg       660
     aagaagaagg gcgaggcgtc cagctacggc gacgtgtttg aaaactcggc ggcgttttca       720
     atggacgacg gcgacttgga ctttggcgcc gagccgctcg cggcggagcc aatcgacgcg       780
     ccgagggtcg tgacggtcgc caaggcggtg cccaagaagg agaagaggga ggaggcgaag       840
     gaggccaagg cggtggatcc cgcggacccg ggtaaggggg agaagaaggc ttcgcagact       900
     ctgaaaaagt ggggtttcgc gcagtcaaac atcgacgacg cgctgggagc gacggaggag       960
     gcggcggcga cggccgtggg cgaggggcag acggcgtaca acaagaggcg gcaggtgctg      1020
     gcgctggact ggctgctgct caacgcgccg gaggatgcca tcccgatgga ctatcgcaac      1080
     gacgccatca aggcgaggtc gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page