(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE13

MICSR_1.PE13         Location/Qualifiers
FT   CDS_pept        complement(26475..27071)
FT                   /codon_start=1
FT                   /gene_family="HOG000125745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636018"
FT                   /orf_name="MICPUN_107847"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62035.1"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AA54"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P0"
FT                   /transl_table=1
FT                   /translation="MKPNRRGSAVSVRAAGDPPSIYGSPGSRTQIVEWLALELGQDIKS
FT                   VNLNRAIMSSPEYRDVHPFGKIPACKAADGTGIFESGAIMLYLADLAGSLPTPEARGEA
FT                   AAWVIWANATMWPALEASRGKCNLENLFGPVDAILADKAWLLGSELSVADVAVASYIKY
FT                   GQLFFRMDIKAFPNVVRYMEQVEQREAFQSTVMGG"
     atgaagccca accgccgggg atccgccgtc tctgttcgcg cagccgggga tccaccttcc        60
     atctacggtt ctcccggaag ccgcacgcag atcgtggaat ggcttgcgct cgagctcggt       120
     caggacatca agagcgtgaa cctcaaccgc gcgatcatgt cctcgcccga ataccgcgac       180
     gtgcatcctt tcggcaagat tccagcgtgc aaggctgcgg acggcaccgg gatcttcgag       240
     tctggagcca tcatgctgta ccttgctgac cttgctggct ctttgccaac ccccgaggcg       300
     aggggcgagg ccgccgcgtg ggtcatctgg gcgaacgcca ccatgtggcc ggcgcttgag       360
     gcgagcaggg gcaagtgcaa cctggaaaac ttgttcgggc cagtagacgc gatcctggca       420
     gataaggcgt ggctcctggg ctcggagctc tccgtggctg acgtcgcggt tgcttcgtac       480
     atcaagtacg gacagctgtt ctttcgtatg gacatcaagg cgttccccaa cgtggtcagg       540
     tacatggagc aggtcgagca gagggaagct ttccagtcga ccgtcatggg aggttaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page