(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE130

MICSR_1.PE130        Location/Qualifiers
FT   CDS_pept        join(245771..246097,246346..246711)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636470"
FT                   /orf_name="MICPUN_56703"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO61649.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniParc:UPI000199A7B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E107"
FT                   /transl_table=1
FT                   /translation="MAAFTVSMSALVGAPVKVRRIARARAQFVPSSVVGTSPAPQGFHG
FT                   RSGEKASGERRAETTRRENRERSTRARHATGARARSSLAILAARESGEAARRSQTARAA
FT                   RDVIAARAVVARKAVQQRGARLIVRAEGEEAKADSFAGLKPTKAADFKSMSNDELNAQI
FT                   VEAKKMLFELRMKQSTRKEYKGHHFGILKTKIAQIRTVKREREVTEGVNKRDSRKIKRE
FT                   ERAANIYL"
     atggccgctt tcaccgtctc catgtccgcc ctcgtcggcg cgcccgtcaa ggttcgtcgc        60
     atcgcacgcg ctcgcgcgca attcgtgcca tcgtcggtgg tcggaacgtc gccagcacca       120
     cagggttttc acgggaggtc gggcgaaaaa gcgagcggcg agcgccgcgc ggaaacgacg       180
     cgccgcgaga atcgcgagcg gtcgacgcga gcgcgtcacg cgaccggcgc gcgcgctcgt       240
     tcatcgctcg cgattctcgc ggcgcgtgaa tccggggagg ccgcgcgtcg atcgcagacc       300
     gcgcgcgccg ctcgcgacgt catcgccgct cgcgccgtcg tcgcccgcaa ggctgtccag       360
     cagcgcggcg cccgcctcat cgtccgcgcc gagggcgagg aggccaaggc ggactccttc       420
     gcgggcctca agcccaccaa ggctgccgac ttcaagtcca tgtccaacga cgagctcaac       480
     gcgcagatcg tcgaggcgaa gaagatgctc ttcgagcttc gcatgaagca gtccacgcgc       540
     aaggagtaca agggccacca cttcgggatc ctcaagacga agatcgcgca gattcgcacc       600
     gtgaagcgcg agcgcgaggt taccgagggt gtcaacaagc gcgatagccg caagattaag       660
     cgcgaggagc gcgcggccaa catctacctg taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page