(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE131

MICSR_1.PE131        Location/Qualifiers
FT   CDS_pept        complement(246949..248274)
FT                   /codon_start=1
FT                   /gene_family="HOG000006282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636471"
FT                   /orf_name="MICPUN_56704"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62094.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG664087"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniParc:UPI000199A7B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E108"
FT                   /transl_table=1
FT                   /translation="MAPLRASSIVRRGLPDARDDEALIATPVVEVDEATPREDDVDEWF
FT                   PPFAASAPKLGLAGLGAGLLNTGFELDGPASTIEAIVVLATIIFVHECGHFFAARLQNI
FT                   HVSKFSVGFGPNLLSYKGPEVEYSLRWVPLGGFVAFPDDDPDCPYPQDDPDLLRNRPIK
FT                   DRAIVISAGVAANVAFALAILNFQVNTVGLVEQAYKPGVKVAQLLSTSAAREYGVKVGD
FT                   VITAIDGEALPAAGKSVNDVVAKVKAAGSNPVRLKIQRFGTNGPAPPVDIEVVPKTGVN
FT                   GEGRIGVQLEANAEVRKRVAGNPAEGLFLATKEFARLTGLVCKSLFSLVSNFSQAKDNV
FT                   SGPIAIVGVGAEVMRGSDLSGLYQFASVININLAVVNILPLPALDGGFLLLIAVEALRG
FT                   GKKLPAEVEQSITASGVLLLLGSGMFLILRDTLNLVGSLGQH"
     atggcgccgc tccgcgcgtc ttccatcgtg cgaaggggac tccccgatgc gagggacgat        60
     gaggcgctca tcgcgacgcc ggtcgtcgag gtcgacgagg cgacgccgcg cgaggacgac       120
     gtggacgagt ggttcccgcc gttcgccgcc tccgccccaa agctcggact cgcgggcctc       180
     ggcgcgggtc tcctgaacac cggcttcgag ctggacggac ccgcgagcac catcgaggcc       240
     atcgtggtcc tcgccaccat catcttcgtg cacgagtgcg gacacttctt cgccgccagg       300
     ctccagaaca tccacgtctc caagttctcc gtcggattcg gccccaacct cctgtcctac       360
     aagggtccgg aggtggagta ctcgctacga tgggtcccgc tcgggggatt cgtcgccttt       420
     cccgacgacg acccggactg cccgtacccc caggacgacc cggacttact caggaaccga       480
     cccatcaaag acagggccat cgtcatctcc gcgggtgtcg ccgccaacgt agcattcgcg       540
     ctcgccattt taaacttcca ggtgaacacc gtcggcttgg tggagcaggc gtacaagccc       600
     ggggttaagg tggcgcagct gctgagcacg tccgcggcga gggagtacgg cgtgaaggtt       660
     ggcgacgtca tcaccgcgat cgacggcgag gcgttacccg cggcgggaaa gtcggtgaac       720
     gacgtcgtcg ccaaagttaa agccgcgggt tcgaatccgg tgcgactcaa gatacagcgt       780
     tttggcacga acggaccagc gccgcccgtg gacatagagg tggtgcccaa gacgggggtg       840
     aacggcgagg ggcggatcgg ggtgcagctc gaggcgaacg cggaggtacg gaagcgcgtc       900
     gccggtaacc cggcggaggg gctgttcctg gcgacgaagg agtttgcgcg actcaccggt       960
     ctggtgtgca agtcgctgtt ctcgctcgtg tccaacttca gccaggcgaa ggacaacgtg      1020
     agcgggccga tcgcgatcgt gggcgtgggc gcggaggtca tgcgggggtc cgacctgagc      1080
     ggtctgtacc agttcgcgtc cgtcatcaac atcaacctcg ccgtcgtcaa catcctcccg      1140
     ctgccggcgc tggacggggg tttcctgctc ctcatcgccg tcgaggcgct gcggggcggg      1200
     aagaagctgc cggcggaggt ggagcagagc atcaccgcga gcggggtgtt gctgctgctc      1260
     gggtcgggga tgttcctcat cctgcgggat acgctgaacc tggtggggtc cctgggccag      1320
     cactga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page