(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE133

MICSR_1.PE133        Location/Qualifiers
FT   CDS_pept        250416..252305
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636473"
FT                   /orf_name="MICPUN_52144"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61651.1"
FT                   /db_xref="UniParc:UPI000199A7BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E110"
FT                   /transl_table=1
FT                   /translation="MGVRDVAAAAAAAGTNWLSTSPLSRRPGFLGGTSPGGGRPLGGSG
FT                   SHQKPPLSSSPSVARAASFGGFTPGGDGVSVEIQPVPFSLQGSKARSGSDRSLNSMDAE
FT                   YVLVEDDKSGGDKSGGLASMESSPGGSLPSGGGGGGGGLTQMAAGLTRRLSSNLGAVIL
FT                   GSSPPPSKFGNNHHHVTSSSSSPGRELYRMSSSPGGTGLGSGGSPGSFPPRPGSSRHSP
FT                   PGMLGEFRNSPSYPSSRVSSARSGGGGGSGLALGAGASLAPSQSPSEKEAAAALALARV
FT                   AQAAAAAAPGEKRFASAAQRVSVLERAATVLRDVAMERWDSGKKLDALSVSLVSLTALR
FT                   EGYKLAQAVAKEAAEAEACSNAPQGVGPLDGSRNVRLSDMSDSSRSSGGGGGGDCASRP
FT                   ASASSSSSGSPPWIPGRSSSSSQSGTIGSSAELPRLSSKTPERLRKDRERAVKTAERIK
FT                   NAFNAALTRADRAAAAVKGVGVEGSAVLPDAMDLAYDAALALGRSGAVEELMGNTRTAL
FT                   EAYSRAQTLLVFILSEGPRFVTARDEQSGDERAATDAERETAAALVSAPGRAAGDGVET
FT                   GDGSRLITPSVHPCDEFPARGRIARFVGAIGARQQACAATAMRSSSGATRRPP"
     atgggcgtca gggacgtcgc cgccgccgcc gccgccgcgg ggaccaactg gctgagcacg        60
     tcgccgctga gccgccgccc cggcttcctc ggcggaacct cgccgggtgg cggtcgaccc       120
     ctgggcggct ccggctcgca ccagaaacct ccgctgtcgt cctccccgtc cgtcgcccgc       180
     gccgcctcct tcggcgggtt cacccccggc ggcgacggcg tctcggtcga gatccagccg       240
     gttccgtttt ccctgcaggg gagcaaggcg cgaagcggca gcgaccggtc gctgaactcg       300
     atggacgcgg agtacgtcct cgtggaggat gacaaatccg gcggcgacaa gtccggcggc       360
     ctcgcgtcga tggagtcctc cccgggcggg tccctcccga gcggcggcgg cggcggcggc       420
     ggcgggctca cgcagatggc ggcggggttg accaggagac tctcgtcgaa cctcggagcc       480
     gtcattctcg gctcgtcacc gccgccgagc aaatttggca acaaccacca ccacgtcacg       540
     tcgtcgtcgt cgtcgcccgg gcgggagctc taccgcatga gctcctcgcc cggcggtacc       600
     ggcctgggct cgggagggag ccccgggtcg tttccgcccc ggccggggtc ctcccgtcac       660
     tcgccccccg ggatgctcgg cgaattccgt aactccccga gttacccatc gtccagggtc       720
     tccagcgcgc gatcaggagg cgggggcggt tcggggctgg cgctcggggc tggcgcgtcc       780
     ctggccccgt cgcagtcgcc gtcggagaag gaggcggcgg cggcgttggc gttggctcgc       840
     gtggcgcagg cggcggcggc ggcggcgccc ggggagaagc gcttcgccag cgcggcgcag       900
     cgcgtctccg tgctcgaacg cgccgcgacg gtcctgagag acgtcgccat ggagcggtgg       960
     gacagcggca agaaactcga cgcgctgtcc gtgtcgctcg tgtcgttgac ggcgctcagg      1020
     gaggggtaca agctcgcgca ggccgtcgcg aaagaggcgg cggaggcgga ggcgtgctcg      1080
     aacgctcccc aaggcgtcgg gcccctggac ggctcgcgaa acgtccggct gtccgacatg      1140
     tccgactcct cgcgatcgtc cggcggcggc ggcggcggcg actgcgcgtc gcggcccgcg      1200
     agcgcgtcgt cgtcgtcgtc ggggtcgccg ccgtggatcc ccggcaggtc ctcctcctcg      1260
     tctcaatccg gcaccatcgg ctcatccgcg gagctccccc gcctctcgtc caagaccccg      1320
     gaacgccttc gcaaggatcg cgagcgcgcg gtcaagactg cggagcggat caagaacgcc      1380
     ttcaacgccg cgctgacgcg cgccgaccgc gccgccgccg cggtcaaggg cgtcggcgtc      1440
     gagggttccg ccgtgttgcc cgacgcgatg gacctcgcgt acgacgcggc gctggcgctc      1500
     ggtcgatcgg gcgcggtcga ggagctcatg ggcaacacga ggaccgcgct cgaggcgtac      1560
     tcgagggcgc agacgctctt ggtgttcata ctgagcgagg ggccgcggtt tgtcaccgcg      1620
     agggacgagc agagcggaga cgaacgagcg gcgacggacg ccgagcgaga gacggcggcg      1680
     gcgctcgtga gtgccccggg gcgcgccgcc ggagacggtg tcgaaaccgg ggacggatcg      1740
     cgtctcatca ccccgtccgt ccacccgtgc gacgagttcc ccgcgcgcgg aaggatcgcg      1800
     aggttcgtcg gcgcgatcgg cgcgaggcag caggcgtgcg cggcgacggc gatgcgctcc      1860
     agctcgggcg cgactcgaag gccaccgtga                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page