(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE134

MICSR_1.PE134        Location/Qualifiers
FT   CDS_pept        complement(252548..254692)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636474"
FT                   /orf_name="MICPUN_56706"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62095.1"
FT                   /db_xref="UniParc:UPI000199A7BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E111"
FT                   /transl_table=1
FT                   /translation="MASSDWESTHLVVGAPEGVVELARDLTPLCDILKPDSEVGKVDLI
FT                   RAKATRLIRVCMRTRIGRECLLRRGGLVPSLLAALAPVAKYEDAGADAGADAGADAGAE
FT                   GEEGDGVGPKDPVLEHAMVCGDLLVKLACASTQTALELVEEHGVVETFHALLRRHDADS
FT                   RACGAVGLRKFAKFSERAAREMVWRGVMDDVRAMLPTCDRYRTPPTTPLAMEKDNILAD
FT                   AFGVGAGDEARAKKVDLEALLSSRKRSSKKDETDETEGGGVVYDGPAVPNMGKPPPPPP
FT                   PFVPKANTPRVVAEVMELLGALLCHSFVADQFIGRVGGDVNKRGLLPSGKHRPTWTTTI
FT                   THQCAPAATYAPPPPPPPPPVMVRKLDEEGNPVQATDEEGVPIVDDEGEPVYEMVEEKP
FT                   KTEETEGVEEPEPEPEPEPEPEPEPLAVSEPEPVAKAEVEHDDMLEEYQPVLIEGDAPC
FT                   DDFLACSASLRCLEHAARHPRCRAELLEDDGAHCKRLAAIVRCNMPHCAEPALRILLGI
FT                   MSWAKHEGPNATGPNSFKDLREAQGRVRGGQGGALAAVKAAKAAREAEERETKGGARAY
FT                   DILRCEEVRGAVMSADLGPEDSVMHRSLRSAASHALAGYELTAILPPPPPPAPVPGMEV
FT                   TARAPLPNHKTTPLLETIEKQTLGREIAERDEMREPFFDQVLTIKERLALRYRQTRGHR
FT                   TSRSGSVKDPNELEEVVTEA"
     atggcgtcga gcgactggga atccacgcac ttggtcgtgg gcgcgcccga gggcgtcgtg        60
     gagctcgcaa gggacctcac gccgctctgc gacatcttga agcccgacag cgaggttggg       120
     aaggttgacc tcatccgcgc aaaggcgact cggctcatcc gcgtctgcat gcgaaccagg       180
     ataggccgcg agtgtctgct gcgaaggggc gggctggttc catcgctcct cgcggcgctc       240
     gcgcccgtgg ccaagtacga ggacgcgggt gccgacgcgg gtgccgacgc gggtgccgac       300
     gcgggtgccg agggcgaaga gggcgacggg gtcgggccga aggatccggt tttggagcac       360
     gccatggtct gcggcgatct gctcgtgaag ctggcgtgcg cgtcgacgca gaccgcgctg       420
     gagctggtgg aggagcacgg cgtcgtggag acgtttcacg cgctgttgcg aaggcacgac       480
     gcggactcta gggcgtgcgg cgccgtcggc ttgcggaagt ttgcgaaatt cagcgagaga       540
     gcggcgaggg agatggtgtg gcgcggggtc atggacgacg ttcgcgcgat gctgcccacc       600
     tgcgacaggt accgcacccc gcccacgacg ccgctggcga tggagaagga caacatcctg       660
     gcggacgcct tcggcgtggg cgccggcgac gaggcgcgcg ctaagaaggt tgacctcgag       720
     gcgctgctct cgagccgaaa aagatcatca aagaaggacg agacagacga aacggaagga       780
     ggcggggttg tctacgacgg tccggctgta ccgaacatgg gcaaaccccc gccgcccccg       840
     ccgccgttcg ttccaaaggc caacaccccg cgggtcgtcg ccgaggtcat ggagctcctc       900
     ggggcgctcc tgtgccattc gttcgtggcg gatcagttca tcggtcgcgt cggcggcgac       960
     gtcaacaaac gcggactact cccgagcggg aagcaccggc cgacgtggac gacgacgatc      1020
     acgcatcagt gcgctcccgc cgcgacgtac gcaccgcctc cgccgcctcc gccgccgccg      1080
     gtgatggtgc gtaagctgga cgaggagggc aacccggtgc aggcgacgga cgaggagggc      1140
     gtcccgattg tcgacgacga gggcgagccg gtgtacgaga tggtcgagga aaagccgaaa      1200
     actgaggaaa ccgagggcgt cgaggagccc gagcccgagc ccgagcccga gcccgagccc      1260
     gagcccgagc cgttggccgt gtccgagccc gagcccgtgg ctaaggctga ggtcgaacac      1320
     gacgacatgt tggaggagta ccaaccggtg ctcatcgagg gcgacgcgcc gtgcgacgac      1380
     tttctcgcgt gttccgcgtc gcttcgatgc ctggaacacg cggcgaggca cccgcggtgc      1440
     cgcgccgagc ttctcgagga cgacggcgcg cactgcaaac gactcgcggc gatcgtcagg      1500
     tgcaacatgc cgcactgcgc ggagccggcg cttcgaattt tgctcgggat catgtcgtgg      1560
     gccaagcacg aaggtcccaa cgcgaccggg ccgaactcgt tcaaggacct acgcgaggcg      1620
     caggggcgcg tgcggggcgg ccagggcggc gcactcgcgg ccgtcaaagc cgcaaaggcg      1680
     gcgagggagg ctgaagagcg cgaaacaaag ggtggcgcgc gagcgtacga catccttcgc      1740
     tgcgaggagg tgcgcggtgc cgtgatgagc gcggatctgg gccccgagga ttccgtgatg      1800
     cacaggtcgc tgcgttccgc ggcgtcgcac gcgctggcgg gatacgagct cacggcaata      1860
     cttcccccgc cgccgccgcc cgcgcccgtg cccgggatgg aggtcaccgc gcgagcgccg      1920
     ttgccgaatc acaagacgac gccgctgttg gagacgatcg agaagcagac tctgggacga      1980
     gagatcgcgg agagggacga gatgcgcgag ccgttcttcg accaggtcct gaccataaag      2040
     gagaggctgg cgctgaggta caggcagacc cgggggcacc gcacgtcgcg gtcgggatcc      2100
     gtgaaggacc cgaacgagtt ggaggaggtg gtcaccgagg cgtag                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page