(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE135

MICSR_1.PE135        Location/Qualifiers
FT   CDS_pept        254745..255992
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636475"
FT                   /orf_name="MICPUN_56707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61652.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A7BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E112"
FT                   /transl_table=1
FT                   /translation="MRLVASGFGAPASSAAATSSSVGSTTLSNGCSWRHTASTQARHPT
FT                   RCRRISPCLVASAWIARRPARRAASSASASRSFTRLSTTSVSASTSASFLKRRGGASRP
FT                   GRGVRMAFGRVDAGSTRLVPNRDRRLLLGMRAIASSGADVPGIRREFPQLRGGVRASRV
FT                   VGRVAKLLGDRRDEVGTIPILRALPRHGASRVWGAAVRIGLSVIVRHARVEKTEMRGTR
FT                   VIRARGAMGRGGHSDDEGTPYDQRLEEVEFMRSACVAAQRGDVDKLRAMLHRRPDVMLD
FT                   DGVGGDSGYTPLHYAAREGHAECVRALLASGANANARTRAGGATPLHRAAFTGSGACVM
FT                   LLLEGGADPCLRDADGESALHKASANGHADVVRALLRAGGERGIAGERDRKGMTPVERA
FT                   ADEATRAAFGDRVGNC"
     atgcgcttgg tcgcctcggg cttcggcgcg cccgcctcct ccgccgcggc gacctcctcc        60
     tcggtcggct cgacgaccct ctcgaacggc tgcagctggc gccacaccgc gtcgacgcag       120
     gcgcggcatc ccacgcggtg ccggaggatc tccccctgcc tcgtcgccag cgcgtggatc       180
     gcgcggaggc cggcgagacg cgcggcgtcc tcggcgtcgg cgtcgaggag cttcacgagg       240
     ttatccacga cgtccgtctc ggcgagtacg tccgcatcgt tcctgaagag acgggggggg       300
     gcatcgcgtc cgggtcgcgg ggtcaggatg gcgtttggac gggtcgacgc gggtagcacg       360
     aggctcgtcc cgaatcggga tcgtcgcctt ttactcggga tgcgcgcgat tgcttccagc       420
     ggcgcggacg tacccgggat ccgtcgcgag ttccctcagc ttcgaggcgg cgtccgcgcg       480
     tcccgcgttg tcggtcgagt cgcgaagctc ctcggcgacc ggcgcgacga ggttgggacg       540
     atccccatcc tccgcgccct cccgcgccat ggcgcctcgc gggtctgggg cgcagcggtc       600
     cgtatcgggc tgtccgtcat cgttcgtcac gccagagttg aaaaaaccga gatgcgaggg       660
     acgcgcgtca tcagagcccg aggcgcgatg ggtcgcggcg ggcactccga cgacgagggt       720
     accccctacg accagcgcct cgaggaggtc gagttcatgc gcagcgcctg cgtcgcggcg       780
     cagcgcggcg acgtcgacaa gctccgcgcc atgcttcacc ggaggccgga cgtgatgctg       840
     gacgacggcg tcggcggcga cagcgggtac acgccgctgc actacgccgc gcgcgagggc       900
     cacgcggagt gcgtgcgcgc gctgttggcg tcgggcgcga acgcgaacgc gcgcacgagg       960
     gcggggggcg ccacgccgct gcatcgcgcg gcgttcaccg ggtccggcgc gtgcgtcatg      1020
     ctgttgctag agggcggggc ggacccgtgc ctgagggatg ccgacgggga gagcgcgctg      1080
     cacaaggcga gcgcgaacgg tcacgccgac gtggtgaggg cgctgcttcg cgcggggggg      1140
     gagcggggga tagcggggga gcgggatagg aaggggatga cgccggtgga gcgcgcagcg      1200
     gacgaggcga ccagggcagc tttcggcgat cgagtcggga attgctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page