(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE136

MICSR_1.PE136        Location/Qualifiers
FT   CDS_pept        256081..257505
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636476"
FT                   /orf_name="MICPUN_56708"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61653.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A7BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E113"
FT                   /transl_table=1
FT                   /translation="MPKTPASYETKDLKKLKVADLRAILESKGLDATGKKDELIEKVQA
FT                   SNDAPEPAPEPEPEPEPEPEPEPAPEKSPPAKKPAAKEKPAAKETPAAEEDDDDEPRRA
FT                   NDFFFSTAGADDDDDDDDDEKDEDPAPEPEAPVDRDDDRPATDTRDADDDADDDDDDDT
FT                   AGDEIYLGFLGENCNREFIANLLRPFFECERVHLPMQSAPGGGPKRPKGYAFVRPPRGT
FT                   PDSALAAAVEKLNGSASYPGAKHPLKIAMATRKTNDDDDARGTKRRRDGSGSGGVPQGK
FT                   SPNRLYVLGLPRHVTEVLLKEFFSRFGAVTDARVLASRDGEDDVGPRRGTVTFASADDA
FT                   ARARAETDNTRAFHGGGELKVVYSNLRDGEGGRRGGGGGGGGGGVGGGGASAQPWSVYP
FT                   MQPGMPMYTPMAAVALDPATGQPFAPTGVAAGAGLADHPAAVPPTGLSEAGYTGVHLAG
FT                   LPPSATVDAKYAHLYQ"
     atgccgaaga cgcccgcaag ctacgagacg aaggacctga agaaactgaa ggtggcggac        60
     cttcgcgcca tcctcgagtc gaaaggtctg gacgccaccg gcaagaagga cgagctcatc       120
     gagaaggtgc aggcgtcgaa cgatgcgccc gagcccgccc ccgagcccga gcccgagccc       180
     gagcccgagc ccgagcccga gcccgccccc gagaaatcgc cacccgcgaa gaagcccgcg       240
     gcgaaggaga agcccgcggc gaaggagacg ccggcggcgg aggaggacga cgacgacgag       300
     ccgaggcgcg cgaacgattt cttcttctcc accgcgggtg cagacgacga cgacgacgac       360
     gacgacgacg agaaggacga ggaccccgct ccggaacccg aggcgcccgt cgaccgggac       420
     gacgaccgac ccgccaccga tacccgcgac gccgacgacg acgccgatga cgacgacgac       480
     gacgacacag ctggcgacga gatctacctc gggtttctgg gcgaaaactg caatcgcgag       540
     tttatcgcca acctcctccg cccgttcttc gagtgcgaac gcgtgcatct cccgatgcag       600
     tccgccccgg gcggcgggcc gaagcgaccg aaggggtacg ccttcgttcg ccctcctcga       660
     ggcacgcccg actccgcgtt ggccgccgcc gtggagaagc tcaacggaag cgcttcgtac       720
     ccgggagcga agcacccgct caagattgcg atggcgacca gaaagacgaa cgacgacgac       780
     gacgcgaggg ggaccaagcg ccggcgcgat gggtccggca gcggcggcgt gccccagggt       840
     aagtccccga accgcctcta cgttctcggc ctcccgcgac acgtcaccga ggtgttgctc       900
     aaggaatttt ttagtcggtt cggcgccgtg acggacgcga gggtgctggc gagcagggac       960
     ggcgaggacg acgtcggccc gcggcgcggc acggtgacgt tcgcctccgc cgacgacgcg      1020
     gcgagggcga gggcggagac ggataacacg cgagcattcc acggcggcgg ggagctgaag      1080
     gtggtttact ccaacctccg cgacggggag ggtgggcggc gcggcggcgg cggcggcggg      1140
     ggaggcgggg gcgtgggagg cggaggcgcg tccgcgcagc cgtggagtgt gtacccgatg      1200
     cagccgggga tgccgatgta cacgccgatg gccgcggtcg cgttggaccc ggccaccggc      1260
     cagccgttcg cgccgaccgg ggtggcggcg ggggcggggc tcgccgatca tcccgccgcg      1320
     gttccgccca ccgggctgtc agaggcgggg tacacggggg tacacctcgc gggtctgccc      1380
     ccgtccgcga cggtggacgc caagtacgcg cacctgtatc agtga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page