(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE137

MICSR_1.PE137        Location/Qualifiers
FT   CDS_pept        complement(257608..258612)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636477"
FT                   /orf_name="MICPUN_56709"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62096.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A7BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E114"
FT                   /transl_table=1
FT                   /translation="MATKTTIWRPNVRVSLDEYGEVEDTESGGEEVAKQGTKRKRAPPT
FT                   KGPCEHGVKPRSRCKVCSACPHGKWRKQCKECGGASICEHGRIRSVCKECGGASICEHG
FT                   RQRSQCKECGGSEICEHGRHRSKCKECGGSQICEHGRQRHRCKECGGSSICEHGRHRPQ
FT                   CKECGGASICEHGRHRYSCKECGGASICEHGRHRSKCKECGGSQICEHGRQRSRCKECG
FT                   GGSICEHGRERSLCKECGGSQICEHGRRRSRCKECGGGSICEHGRIRSQCKECGGASIC
FT                   EHGRQRSQCKECGGSQICEHGRRRSQCKECGGGSICEHGRIRSQCKDCRCERL"
     atggcgacga agacgacgat ttggcggccg aacgtgagag tgtccctcga cgagtatggc        60
     gaagtcgagg acacggagag tgggggagag gaggtggcga agcaggggac gaagcggaag       120
     agagcccctc ccacgaaggg gccatgcgag cacggggtga agcctcggtc gcgatgcaag       180
     gtgtgcagcg cttgtccgca cgggaagtgg cgcaaacagt gcaaggagtg cggtggtgca       240
     tcaatctgtg agcacggtcg tatacgctct gtgtgtaagg agtgcggtgg tgcatcaatc       300
     tgcgagcacg gccgtcagcg ctctcagtgc aaagagtgcg gcgggtctga aatctgcgag       360
     cacggtcgtc accgctctaa gtgcaaggag tgcggcgggt ctcaaatctg cgagcacggc       420
     cgtcagcgcc acaggtgcaa ggagtgcggt gggagctcaa tctgcgagca cggtcgtcac       480
     cgccctcagt gcaaggagtg cggcggggca tcaatctgcg agcacggtcg tcaccgctac       540
     agctgcaagg agtgcggcgg ggcatcaatc tgcgagcacg gtcgtcaccg ctctaagtgc       600
     aaggagtgcg gcgggtctca aatctgcgag cacggccgtc agcgctctcg gtgcaaggag       660
     tgcggtgggg gctcaatctg cgagcacggt cgtgagcgct ctctgtgcaa ggagtgcggt       720
     gggtctcaaa tctgcgagca cggtcgtagg cgctctcggt gcaaggagtg cggtgggggc       780
     tcaatctgcg agcacggtcg tatacgctct cagtgcaagg agtgcggcgg ggcatcaata       840
     tgcgagcacg gccgtcagcg ctctcagtgc aaggagtgcg gcgggtctca aatctgcgag       900
     cacggccgtc ggcgctctca gtgcaaggag tgcggtgggg gctcaatctg cgagcacggt       960
     cgtatacgct ctcagtgcaa ggactgtcga tgcgaacggc tgtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page