(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE138

MICSR_1.PE138        Location/Qualifiers
FT   CDS_pept        258710..259990
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636478"
FT                   /orf_name="MICPUN_56710"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61654.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560005"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199A81D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E115"
FT                   /transl_table=1
FT                   /translation="MSREGEAPDPPGPLPATPALCRHWARRGRCDYGDGCRFRHERVPG
FT                   DDADADDPRVSAMDGRREGATRFGRRHHARNRNKAGDFRRWLVATFGFETLASGAGVLD
FT                   VAGGKGELAFELRNLSGIPVTVVDPRPMRLERYVRRFRSGMYHRNQSPAAAKLRRPLDS
FT                   TLAAPDHLRMFLHRGVFDPARSDGERRLAAIESHRLSHATRWSRRGLVDGESAPGDGDG
FT                   DGESAPGDGVRDGANLDEAYRIPGEPVRHATMFSEIPRRRDPDADDVESDVYADVEADV
FT                   EADVDDPDAAAMTPVAMDASATADACERVFRDCSVVVGLHPDQATDAAVDLALAFGKPF
FT                   AVVPCCTYSRDFPHRRLPPGPGRPRGGGAVTTHAHLVEYLLAKAAPGTTIERDELPFEG
FT                   KNVVVYSLGDGGSELLCRAVDGLGVGE"
     atgtctcgcg agggggaggc gccggatccc cccgggccac tcccggcgac ccccgcgctg        60
     tgccgccact gggcgaggag gggacggtgc gactacggcg acggatgcag gttccggcac       120
     gaacgcgtcc cgggcgacga cgccgacgcc gacgacccgc gcgtctccgc catggacggc       180
     cgacgcgagg gtgccacgcg gttcggtcgc aggcaccacg cgcggaacag gaacaaggcg       240
     ggcgacttcc gacgatggct ggtggcgacg ttcgggttcg agacgctcgc gtcgggcgcg       300
     ggggtcctgg acgtggcggg aggcaagggc gagctcgcgt tcgagctgcg caacctcagc       360
     ggcatcccgg tgacggtggt ggatcctcgg ccgatgcggc tggaacgata cgtgcgacgg       420
     ttcaggtcgg ggatgtacca caggaaccaa tcgcccgcgg cggcgaagct gcgcaggccc       480
     ctcgattcga ccctcgccgc acccgatcac ctccggatgt tcctgcaccg aggcgtgttc       540
     gacccggcgc gatcggacgg ggagaggcgt ttggcagcca tcgagtctca ccggttgagt       600
     cacgccacga ggtggtcgcg ccgggggctc gtggacgggg agtcggcacc cggggacggg       660
     gacggggacg gggagtcggc acccggggac ggggttcggg acggcgcgaa cctcgacgag       720
     gcgtacagga tacccggcga gcccgtgcga cacgcgacga tgttctccga gatcccgcgt       780
     cgccgagatc ccgacgctga tgacgtggaa tctgacgtgt atgctgatgt ggaagctgac       840
     gtggaagctg acgtggacga tcccgacgcc gcggcgatga cacccgtcgc gatggacgcg       900
     tccgcgacgg cggacgcgtg cgagcgcgtc ttccgcgact gctccgtcgt cgtcgggtta       960
     caccccgatc aggccacgga cgcggcggtg gacctggcgc tcgcgttcgg taaacccttc      1020
     gcggtggtgc cgtgctgcac gtacagcagg gatttcccgc acaggcgctt gccccctggg      1080
     cccggtcggc cgcggggcgg cggcgcggtg acgacgcacg cgcacctcgt ggagtacctg      1140
     ctcgccaagg cggctccggg gacgacgatc gagcgagacg agttgccgtt cgaggggaag      1200
     aacgtggtgg tgtactcgct cggcgacggg gggtcggagc tgttgtgccg cgcggtggac      1260
     gggctcgggg ttggcgagtg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page