(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE139

MICSR_1.PE139        Location/Qualifiers
FT   CDS_pept        complement(260485..261324)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636479"
FT                   /orf_name="MICPUN_99310"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62097.1"
FT                   /db_xref="UniParc:UPI000199A81E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E116"
FT                   /transl_table=1
FT                   /translation="MASSDDDVTRPPEEGLTVSASIGPRFGNAGVWREAVANSYYAARA
FT                   DEDEISLRVAEADREARESARWREECEKERRAIAERIKARHGAYPPKPAPATPAEMDAR
FT                   RASKKAEIMRLSKRDEENKMLRARILPPHQYDGEFPEEMRKHGRVLEHGGVYADTALWR
FT                   RHEAEWEEFMETARGMSIIRKRQIPFPEAGGAALYRHLILKSIHEFNLSEEDAEKFAFR
FT                   RCAMRWHPDKVMTAVGIRLLPEEYDEVGAKCVEVFREVQEEHKNRLRLRGTLPSGCD"
     atggcgtcga gcgacgatga cgtgacccgg ccgccggagg aggggttgac ggtatcggcc        60
     tccatcggcc cgcgttttgg caacgcgggc gtgtggagag aggctgtcgc caactcctac       120
     tacgccgcgc gcgcggacga ggacgagatc tcgctgcgcg tcgccgaggc tgaccgcgaa       180
     gcccgggaat cggcgaggtg gagggaggaa tgcgagaagg agagacgggc catcgcggaa       240
     cgcatcaagg cgcgccacgg cgcgtatccc ccgaagcccg cgcccgcgac gcctgcggag       300
     atggacgcca ggcgcgcgag caagaaggcg gagatcatgc gcttatcgaa gcgggacgag       360
     gagaacaaga tgctgcgcgc gcgaatcttg cccccgcacc agtacgacgg cgagtttccc       420
     gaggagatga ggaagcacgg gcgggtgctg gagcacggcg gcgtgtacgc cgacaccgcg       480
     ctctggcgca ggcacgaagc cgagtgggag gagttcatgg agaccgcgcg cgggatgagc       540
     atcatacgca agcgacagat ccccttcccc gaggcgggcg gcgcggcgct gtaccgtcac       600
     ctcatcttga aatccatcca cgagtttaac ctctccgaag aggatgccga gaagttcgcg       660
     tttcgccggt gcgccatgcg ttggcacccg gataaggtga tgaccgccgt ggggatccga       720
     ctgcttccgg aggagtacga cgaggtcggg gccaagtgcg tggaggtgtt ccgggaggtc       780
     caggaggagc acaagaacag gctgaggctg cgggggacgc tgccgagcgg ctgcgactaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page