(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE14

MICSR_1.PE14         Location/Qualifiers
FT   CDS_pept        join(27285..28396,28457..28661)
FT                   /codon_start=1
FT                   /gene_family="HOG000280651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636019"
FT                   /gene_name="CNX1E"
FT                   /orf_name="MICPUN_79735"
FT                   /product="Molybdenum cofactor biosynthesis protein CNX1E "
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="ACO61591.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG731522"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniParc:UPI000199AA55"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P1"
FT                   /transl_table=1
FT                   /translation="MISMNEAVDRVISRAHPLPQESVAFVDAVGRVVAEDFVAPRPHPP
FT                   FAASVMDGYAVRSADCPGVMTLIGASRAGAPMRGSGNTSIQPGQCAYITTGAPLPPGAD
FT                   AVVPSEECRVDGGTVSIDANVDAGKWVRPVGFDIKAGETLVPAGSLVGAHEVGIVAAAG
FT                   GGEICVHRKPKLALLSTGDELAEAGEVEPDASSGRIYDANRPMLAALAKTSGVDDVLDL
FT                   GRAVDDPGALASLVARAHAEGCDVLVTSGGVSEGDRDYLKEVLLGEHGGGIEGEVHFGR
FT                   VMMKPGKPLTFAEVQSKTDCGGNKMLVFALPGNPVSAAVTFHLVVVPTLRRMMGWRDPR
FT                   LRRVHVVVSSDLKLDPERPEYHRATLDWQEHTRHLPAAHSTGKQVSSRLTSMRGAEVLM
FT                   ELPRGPGMVAKGTVVSALVIGNLSSASVQLPAISPEVVR"
     atgattagca tgaacgaggc ggtggatagg gttatcagcc gcgctcatcc acttccccaa        60
     gaatctgtcg cgttcgtcga tgccgtcggc cgcgtcgtgg ccgaggattt cgtcgctcct       120
     cgtccgcacc cgccgtttgc cgcgtcagtc atggacgggt acgccgtgcg tagtgcggac       180
     tgccccggcg taatgactct cataggcgcg tctcgggcgg gtgcacccat gcgaggctcc       240
     gggaacactt ccatccaacc cggacagtgc gcgtacatca ccaccggggc accgctcccc       300
     ccgggcgccg acgccgtggt cccatccgag gaatgccgag tggacggcgg cacggtctcg       360
     atcgacgcta atgttgacgc cggcaagtgg gttcgacccg tcggattcga catcaaggct       420
     ggggagacgc tggtgcccgc cggatcgctg gtgggtgcgc acgaggttgg catcgtagcg       480
     gcggcgggcg gcggtgagat ttgcgtccac cggaaaccga agctcgcgct gctctccacc       540
     ggcgacgagc tcgcggaggc tggagaggtg gagcccgacg cttcgtccgg caggatatac       600
     gatgccaacc gcccgatgct cgcggcgctg gccaagacat ccggcgtgga cgacgttctg       660
     gacctcggtc gagcggtgga tgatcccggc gccctcgcgt cgctcgtggc tagggcgcac       720
     gcggagggat gcgacgtgct cgtcacgtcc gggggggtgt ccgaggggga cagggattac       780
     ctcaaggagg ttttgctcgg agagcacgga ggtggcatcg aaggtgaggt gcacttcggg       840
     agggtgatga tgaaaccggg gaagccgctg actttcgccg aggtgcaatc gaaaacagac       900
     tgcggcggga acaagatgct cgttttcgcc ctgcccggga atccggtcag cgcagcggtg       960
     accttccacc ttgtcgttgt gccgacttta cggcggatga tgggttggcg cgatccgagg      1020
     ctgcggcggg tccacgtggt cgtctcttca gatttgaagc tcgacccgga gagaccggag      1080
     taccatcgcg cgacgctgga ctggcaagag catacacgtc atctaccagc agcgcacagc      1140
     acgggcaagc aagtgagctc gaggctgact agcatgaggg gcgcggaggt gctcatggag      1200
     cttccaaggg gtcccgggat ggtggcaaag gggacagtgg tttcagcgct cgtcatcgga      1260
     aacttatctt cagcgagcgt gcagctcccg gctatctcgc cggaggtggt gcgatga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page