(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE140

MICSR_1.PE140        Location/Qualifiers
FT   CDS_pept        263002..263742
FT                   /codon_start=1
FT                   /gene_family="HOG000200133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636480"
FT                   /orf_name="MICPUN_107875"
FT                   /product="Predicted protein"
FT                   /function="magnesium ion binding"
FT                   /function="phosphatase activity"
FT                   /biological_process="nucleotide metabolic process "
FT                   /protein_id="ACO61655.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009117"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="UniParc:UPI000199A81F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E117"
FT                   /transl_table=1
FT                   /translation="MIDKIIQLMEIGVHVAIVTAAGYPGDSKKFEGRLRGLLDSFKENE
FT                   LTAETRKRFSVMGGECNYLLEVNEEFELEFVDPAVWRDQPSTKNLYWYAQGEAKTKVEA
FT                   FLDRAEQFLKDEAEHLELDYEVMRKEFAVGILPQSSTVYENLEEISIGAMIELSDAEVP
FT                   YCAFNGGNDVFVDVGNKNIGLQTLMNYLGFEGHQTLHVGDRFTSTGNDSRVRDACSILW
FT                   VASPDETTFFMRLLYRDIVNARVL"
     atgatcgata agatcatcca gctgatggag attggcgtcc acgtcgccat cgtcacggcg        60
     gcgggatatc ccggggattc caaaaagttc gaggggcggc tgcggggttt actcgactcg       120
     ttcaaggaga acgagctgac tgcggagacg aggaagcggt tcagcgtgat gggcggcgag       180
     tgcaactacc tgctggaggt taacgaagag tttgagctcg agtttgtcga cccggcggtg       240
     tggcgggacc agcccagcac caagaatctg tactggtacg cgcagggcga ggctaagacc       300
     aaggtggagg cgttcctcga ccgcgccgag cagttcctca aggacgaggc ggagcacctg       360
     gagctcgact acgaggttat gcgcaaggag tttgcagttg ggatcctgcc gcagtcttcg       420
     acggtgtacg aaaatctcga ggagatttca atcggcgcaa tgatcgagct gtcggacgcg       480
     gaggtccctt actgcgcctt caacggcggt aacgacgtgt tcgtcgacgt ggggaacaag       540
     aacatcggtt tgcagacgct gatgaactac ctcggcttcg agggacacca gacgctgcac       600
     gtgggtgaca ggttcacgag caccggaaac gacagccgcg tgagggacgc gtgctcgatc       660
     ctgtgggtgg cgtccccgga cgagacgacg ttcttcatgc gcctgctcta ccgcgacatc       720
     gtgaacgcgc gcgtcctgta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page