(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE141

MICSR_1.PE141        Location/Qualifiers
FT   CDS_pept        join(complement(265668..266273),c
FT                   omplement(<264888..265283))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636481"
FT                   /orf_name="MICPUN_79876"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62098.1"
FT                   /db_xref="HOGENOM:HBG609687"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI000199A820"
FT                   /db_xref="UniProtKB/TrEMBL:C1E118"
FT                   /transl_table=1
FT                   /translation="MDVTGGPKSTGYAGATKAKAKSDGKDSLRKLFKLPDDEVLIEEYL
FT                   CALYKKILLQGRMYLFRNYVCFYSNVFGYQKNKVIPLKDVTIVRRAYTVKVVPNAIEIV
FT                   CNGKCEFFTSFIFPDRAYRNITNAWKECSQYAKIFAAADVDNSKVAAEMLVVPKFSSPP
FT                   SAEVAAMLGLRDGGDGGDDDDAGSKGSGPRSSGSDGPRSDDDVDDDVDDDVDVANEDDF
FT                   GERLVATSTPVPPRPSDMRTLEECVLECAVEDVFSLVWSDSAAGAFGAEDHASRGETAV
FT                   QTTKWSRHRHHGHARDLTFIAPVNASIGPKQTNCHQTQSYHACRGGALVVDTS"
     atggatgtca ccggcggacc gaaatccacg gggtacgcgg gcgcgacgaa ggccaaggcg        60
     aagagcgacg gcaaggactc gctgcgtaag ctgttcaagc tgccggacga cgaggtgctc       120
     atcgaggagt acctgtgcgc gctgtacaag aaaattttgc tccaagggcg gatgtacctc       180
     ttccgcaact acgtgtgctt ctacagcaac gtgttcggct accagaagaa caaggtgatc       240
     ccgctgaagg acgtgacgat cgtgcgcagg gcgtacaccg tcaaggttgt gcccaacgcc       300
     atcgagattg tgtgcaacgg caagtgcgag ttcttcacgt cgttcatatt ccccgacaga       360
     gcctatcgga acataaccaa cgcgtggaag gagtgcagcc agtacgcgaa gatcttcgcc       420
     gcggcggacg tggacaacag caaagtggcg gcggagatgc tggtcgtgcc caaattttcc       480
     tcgcctccct ccgcggaggt ggccgcgatg ctcggccttc gtgacggcgg cgacggcggc       540
     gacgacgacg acgccggctc gaaggggtcc ggcccgagga gctccggcag cgacggcccc       600
     cggagcgacg atgacgtgga cgatgacgtg gacgatgacg tggacgtcgc gaacgaggac       660
     gatttcggtg agcgactggt cgccacgtcc acgccggtcc ccccccgccc gtcggacatg       720
     cgaacgctcg aggagtgcgt gctcgagtgc gccgtcgagg acgtcttctc gctggtttgg       780
     tcggacagcg cggcgggcgc gtttggagcc gaggatcacg cgtcccgggg cgagacggcg       840
     gtgcagacga ccaaatggag ccggcacagg caccacggtc acgccaggga cctcacgttc       900
     atcgcgcccg tcaacgccag catcggtccg aagcagacca actgccacca gacgcagagc       960
     taccacgcgt gcagaggcgg ggcgctggtg gtggacacga gc                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page