(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE142

MICSR_1.PE142        Location/Qualifiers
FT   CDS_pept        <267775..>268128
FT                   /codon_start=1
FT                   /gene_family="HOG000035674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636482"
FT                   /orf_name="MICPUN_73414"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61656.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609689"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199A821"
FT                   /db_xref="UniProtKB/TrEMBL:C1E119"
FT                   /transl_table=1
FT                   /translation="ALLESWPDFRAATDRSNRQVLAPLTRGDLVTVSALPAVAEEALFR
FT                   GCVVPALGGGPLGVIVSGMTFGALHVGGGRNAAFAAWASAVGCLYGACAVGCGDVSVAI
FT                   AAHAMANYASATMW"
     gcgcttctcg agtcgtggcc cgattttcgc gccgccacgg acaggtccaa ccgccaggtg        60
     ctcgcgcccc tcacgcgcgg cgacctggtc accgtcagcg ccctgcccgc ggtggcggag       120
     gaggcgctgt tccgcgggtg cgtcgttccc gcgctcgggg gtggaccgtt gggggtcatc       180
     gtctcgggga tgacgtttgg cgcgcttcac gtgggtggcg ggcggaacgc ggcgtttgcg       240
     gcgtgggcga gcgcggtggg gtgtttgtac ggggcgtgcg cggtggggtg cggggacgtg       300
     agcgtggcga tcgcggcgca cgcgatggcg aactacgcgt cggcgacgat gtgg             354
//

If you have problems or comments...

PBIL Back to PBIL home page