(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE143

MICSR_1.PE143        Location/Qualifiers
FT   CDS_pept        complement(268216..268902)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636483"
FT                   /gene_name="HPF_1"
FT                   /orf_name="MICPUN_99313"
FT                   /product="Cysteine-rich protein with zinc finger "
FT                   /protein_id="ACO62099.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A822"
FT                   /db_xref="UniProtKB/TrEMBL:C1E120"
FT                   /transl_table=1
FT                   /translation="MEGSESEEEEKHATKKGVKRKRAPPTKGPCEHGVKYRSNCKVCSA
FT                   CPHGKRRCHCKECGGASICEHGRIRSTCKECGGATICEHGRRRSQCKECGGSQICEHGR
FT                   HRPQCKECGGSQICEHGRRRTECKECGGGSICEHDRVRSQCKECGGSQICEHGRQRSKC
FT                   KECGGSQICEHGRRRTECKECGGGSICEHDRVRSQCKECGGGSICEHDRVRSKCKECRA
FT                   AKARTG"
     atggagggat ctgagagcga agaggaggag aagcatgcga cgaagaaggg cgtgaagcgg        60
     aagagagccc ctcccacgaa ggggccatgc gagcacgggg tgaagtaccg gtcgaattgc       120
     aaggtgtgca gcgcttgtcc gcacgggaag aggcgctgtc attgcaagga atgcggtggt       180
     gcatcaatct gcgagcacgg tcgtatacgc tctacatgca aggagtgcgg cggagcaaca       240
     atatgcgagc acggtcgtcg gcgctctcag tgcaaggagt gcggcgggtc tcaaatctgc       300
     gagcacggtc gtcatcgccc tcagtgcaag gagtgcggtg ggtctcaaat ctgcgagcac       360
     ggtcgccggc gcactgagtg caaggagtgc ggtgggggct caatctgcga gcacgatcgt       420
     gtgcgctctc agtgcaagga gtgcggcggg tctcaaatct gcgagcacgg ccgtcagcgc       480
     tctaagtgca aggagtgcgg tgggtctcaa atctgcgagc acggtcgccg gcgcactgag       540
     tgcaaggagt gcggtggggg ctcaatctgc gagcacgatc gtgtgcgctc tcagtgcaag       600
     gagtgcggtg ggggctcaat ctgcgagcac gatcgtgtgc gctctaagtg caaggagtgt       660
     cgcgcggcaa aggctcgaac tgggtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page