(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE144

MICSR_1.PE144        Location/Qualifiers
FT   CDS_pept        269255..272497
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636484"
FT                   /orf_name="MICPUN_99314"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61657.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199A823"
FT                   /db_xref="UniProtKB/TrEMBL:C1E121"
FT                   /transl_table=1
FT                   /translation="MPRSVGLDASSREALLDLIYRLSREDKDGGDEGGGDARAARGRGS
FT                   GSVEGADEDDADADPTRVRKDRVKEARRAEKERERKEKVLAKALKKDRRASAAEGANSR
FT                   DDGDAKGWASSPHPPGSEVNVSVTSAQGGGETKVMKIKRAADLKDFLSAAKSKLKLKKK
FT                   PLSARLVPSGREIRDTLRLEPMATVSVSADPPTERARERDDDDEDEKSAPGTGDGDIGD
FT                   GDTGDDPTERLREAVASRLRNAERDVDRSRLPPGGSDDATADESTRLLSLLSIDRSERT
FT                   ANATSRQALPAAAVRAEIIAACVDSDSRVSVVTGDTGSGKTTQAPQFVLEHFVAAGEGA
FT                   RCGIVVCQPRRVAAVSIARRVAEERGERVGDVVGYRVRGESRTSNRTRLTFCTTGVLLQ
FT                   RLRWDPTLEGITHVFVDEAHERTADADFLLILLRRLLRSGAAPGLRVTLMSATVDAGRF
FT                   IDYFAGEPGEPTPRSTHIPGRTFPVDEVFVEEYLPSRRRDRGGGEKNGRNGRNGDGHEI
FT                   DYDLLRAAVDKASRDVQRHGQKPLGAVLVFLPGVPEISRAEQAVSDVRDVRVFPLHGQL
FT                   APEDQRAAFAPAPPNKVKVVLATNAAETSVTIPDVTVVIDTGRVKRMTFESRTQLASLT
FT                   EGWCSLASAAQRRGRAGRVRAGVCVRLYERWAAGKSPMADHDEPEMRTAPLDTLVMRAL
FT                   AIAPGEHPAAVLGEALDPPDADAVRAAVERLRAIGAVVVDPRRGNGPGDSPGVSTTPLG
FT                   FHLSLLPVEPRVGKMLVMGCVMGCLSPVLTAAAAMSCRPMFTARGGDRADASAAKRRAS
FT                   RGSRSDHLACVNAFDEWMGSSNRRRTCADLNLSHAAMQDVARTRTQLRKRLEEAGFSPG
FT                   APAANAQTDNDDFVRCVLVAGLFPNVARVGVGPSGRTRVLNNRGVEVAVHPSGVNAAFH
FT                   RDDVDGDDGATRQGRGRRTFSGGGPETGLLVYQEEVTTSKTFIRDTTAVPDASVLLFGG
FT                   ELCVDHASASVSVSTGRSSAVGGGTASRFTFRAPPETGVLFKLLRKELTAVLASAVGDP
FT                   SGNHGTLEGSARGRRVREVLETLFPGSGVSAR"
     atgccgcggt cggtgggact ggacgcgagt tcccgggaag cgctcctcga tctgatatac        60
     cgcctgtccc gggaggataa ggacggcggg gacgagggcg ggggcgacgc gagggcggcg       120
     cgcgggcggg gatccggttc ggtcgagggt gccgacgagg acgatgccga cgcggaccct       180
     acgcgcgtcc gtaaggaccg cgtgaaggag gccagacgag cggaaaagga acgagagagg       240
     aaggaaaagg tcctcgctaa ggctctgaag aaggatcgca gggcgtccgc cgccgagggc       300
     gcgaacagtc gcgacgatgg cgacgctaag ggttgggcat catcgcccca tccgccgggc       360
     tccgaggtga acgtctcggt cacctccgcg cagggcggcg gggagaccaa ggtgatgaag       420
     atcaagcgcg ccgccgacct caaggacttt ctatccgccg ccaagagcaa gctgaaactc       480
     aagaagaagc cgctgagcgc gaggctggta ccctcgggac gggagattcg cgacaccctt       540
     cgactcgagc cgatggcgac ggtgtcggtg tccgcggacc cgccgacgga gcgcgcccgc       600
     gaacgagacg acgacgacga agacgaaaag tcggcaccgg ggaccgggga cggggatatt       660
     ggggacgggg ataccgggga cgatccgacc gagaggttac gagaggcggt cgcgagccgt       720
     ttacgaaacg ctgaacgcga cgtcgatcga tcgagactcc cgccgggtgg gtctgatgac       780
     gcgacggccg acgaatccac ccgtcttctc tccctcctat ccatcgaccg gagcgaacga       840
     accgcgaacg cgacgagccg ccaggcgttg cccgcggcgg cggttcgtgc cgagatcatc       900
     gccgcctgcg tcgattccga ttcgcgcgtc tccgtcgtca ccggtgacac gggctccgga       960
     aaaaccacgc aggcgccgca gttcgtgttg gagcacttcg tcgccgccgg cgagggggcg      1020
     cggtgcggga tcgttgtgtg ccagccgcgg cgcgtcgcgg cggtttcaat cgcgaggcgc      1080
     gtcgcggagg agcggggcga acgcgtcggg gacgtcgtgg ggtaccgagt gcgtggggag      1140
     tcgaggacgt ctaatcggac ccggctcacg ttttgcacca ccggggtgtt acttcagagg      1200
     ctgcgttggg accccacgtt ggagggaatc acgcacgtgt tcgtggacga ggcgcacgag      1260
     cggacggcgg acgcggactt tttgctgatc ctcctccggc gtctgcttcg atcgggcgcg      1320
     gcgcccgggc tgagggtgac gctgatgtcc gcgacggtgg acgcgggtag gttcatcgac      1380
     tacttcgccg gtgagcccgg tgagccgacg cctcggtcga cgcacatccc gggccgaacc      1440
     ttcccggtgg acgaggtgtt cgtcgaggag tacctccctt ctcggcgccg ggataggggc      1500
     ggcggcgaaa agaacggaag gaacggaagg aacggcgacg ggcacgagat tgactacgac      1560
     ctcctccgag ccgcggtgga caaggcgtct cgcgacgtcc aaagacacgg ccaaaagccg      1620
     ctcggagccg tcctggtgtt cctccccggc gtgcccgaga tatctcgagc ggaacaggct      1680
     gtgtcggacg tgcgtgacgt gcgcgtgttc ccgcttcacg gccagctggc gcccgaggac      1740
     cagcgcgccg cgttcgcccc ggcgccgcca aacaaagtca aagtcgtcct cgccacaaac      1800
     gccgcggaga cgtcggtgac catcccggac gtcaccgtcg tcatcgacac cggccgcgtg      1860
     aagcggatga cgtttgagtc gcgaacccag ctcgcgagtt tgaccgaggg gtggtgcagc      1920
     ttggcgagcg cggcgcagcg aaggggtcgc gccggtcgcg tccgcgcggg cgtctgcgtt      1980
     cgactgtacg agaggtgggc ggcggggaaa tctcccatgg cggatcacga cgagccggag      2040
     atgcgtacgg ctccgctgga cacgctcgtg atgcgcgcgt tggcgatcgc gccgggcgag      2100
     caccccgcgg cggtgctcgg cgaggcgctg gacccgccgg acgccgacgc ggtgcgcgcg      2160
     gcggtggaga ggttacgggc catcggcgcc gtcgtcgtcg atcctcgccg ggggaacggg      2220
     cccggtgact caccaggggt ctcgacgacg cctctgggtt tccacctctc gctcctgccg      2280
     gtggagccca gggtgggcaa gatgctggtg atggggtgcg tgatgggatg tttgtctccc      2340
     gtgctcaccg cggcggctgc catgtcgtgc aggcccatgt tcaccgcgcg cggcggcgac      2400
     agggccgacg cgtccgcggc aaagcgaaga gcctcgaggg gctcgagatc ggaccacctc      2460
     gcgtgcgtca acgcgttcga cgagtggatg ggctcgagta acaggcgtcg gacgtgcgcg      2520
     gatctaaacc tgagccacgc cgcgatgcag gacgtcgcgc gaacccggac gcagctgcgt      2580
     aagaggctcg aggaggctgg attttcaccc ggcgcccccg ccgcgaacgc gcaaacagac      2640
     aacgacgatt tcgttcgatg cgtcctcgtc gcggggctgt tcccgaacgt cgcgcgcgtg      2700
     ggggtgggtc cgtcgggtcg gactcgggtg ctgaacaatc gcggcgtcga ggttgcggtg      2760
     catccctcgg gggtcaacgc ggcttttcac cgggacgacg tcgacggcga cgacggggcg      2820
     acgagacagg ggaggggtcg acgaacgttt tcgggagggg gccccgagac cggactcttg      2880
     gtgtaccagg aggaggtgac gacgagcaaa acgttcatcc gggacaccac cgcggtgccc      2940
     gacgcgtccg tcttactgtt cggcggtgag ctatgcgtgg atcacgcgtc cgcgtccgtc      3000
     tccgtatcca ccggtcgttc ctcggcggtg ggcggcggga cggcttcgag gtttacgttc      3060
     cgcgcgcctc ccgagacggg ggtgctgttc aagctgctga ggaaggagct tacggcggtg      3120
     ctggcgagcg cggtggggga tccgagcgga aatcacggga cgttggaggg gagcgcgcgg      3180
     ggaaggaggg tgcgggaggt gctggagacg ctcttccccg gatccggtgt ctccgcgcga      3240
     tga                                                                    3243
//

If you have problems or comments...

PBIL Back to PBIL home page