(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE146

MICSR_1.PE146        Location/Qualifiers
FT   CDS_pept        275057..275593
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636486"
FT                   /orf_name="MICPUN_93648"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO61659.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199A825"
FT                   /db_xref="UniProtKB/TrEMBL:C1E123"
FT                   /transl_table=1
FT                   /translation="MSSLAKTRLQTERKGWRKDHPHGFVAKPRTARDGSVDLLNWDCKI
FT                   PGKAGTLWEKGLYPIRLEFTEDYPSKPPKVSFPAGFFHPNVYPSGKVCLSILNEDKGWK
FT                   PSITVKQILVGVQELLDNPNNADAAQEAAYKLFKKSGAEYAKRVRIEAAKYTEAPAGFV
FT                   AGGGATGAEDDVIVL"
     atgagctcgc tggccaagac gcggctgcag accgagcgca agggctggcg caaggatcac        60
     ccccacgggt tcgtcgccaa gccccgcacc gccagggacg gatccgtcga cctcctcaac       120
     tgggactgca agatcccggg caaagctggc accctctggg agaaggggct ctaccccatc       180
     cgactggagt tcaccgagga ttacccgtcc aaaccgccca aggtttcgtt ccccgccggg       240
     ttcttccacc ctaacgtcta ccccagcggc aaggtgtgcc tcagcatcct caacgaggac       300
     aaaggctgga agccctccat caccgtcaag cagatcctgg tgggtgtcca ggagctgctc       360
     gataatccca acaacgccga cgcggcgcag gaggctgctt acaagctgtt caagaagagc       420
     ggagccgagt acgccaagcg ggtgaggata gaggcggcca agtacacgga ggccccggcg       480
     ggtttcgtgg cgggcggcgg cgccacggga gcggaggacg acgtgatcgt tctctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page