(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE147

MICSR_1.PE147        Location/Qualifiers
FT   CDS_pept        285066..287648
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636487"
FT                   /orf_name="MICPUN_56720"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61660.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000199A826"
FT                   /db_xref="UniProtKB/TrEMBL:C1E124"
FT                   /transl_table=1
FT                   /translation="MRLLDLLPNDSWLASKSSGSSSFALLRRPDDRPVPSVSVADMRAH
FT                   IAFLRAVHVHSTRDESSSLYVDGPPLRAAVGDYLAWLAEVSLGPSASPGPCPGEMLVTR
FT                   APTLPVAWCWHVHRLDPHAYVRDCASLVGAVPYPVPGVGFASDEDQVASPQRRIDPPDP
FT                   VSSSSHLADILVAAIGRHAPFLWQVSGAAYNDDAFLLSAASRYEEFVAMTVRARGASLA
FT                   PPLDIDLAWHTHMLRDSEYLRESARMRGVELGAMAHDNGEGMGAHGDTSRLEAPWAKTL
FT                   AAFRETVDVSETDGATAMKSAFEAAVPRGARHRGYAPAWWFARGESVVVVDDFLSPEEC
FT                   EAIVSQMPGPESAMNCPSGKKAQMYVDGDASVEARIRAAVSVGLGFEGEPEASKSSLVL
FT                   EDIVNRETGIGGTRSDQFDPHRSLTVERTTPTVKLPARVSVGTMHPHRDRLAIYTLEGE
FT                   TMFEDDTLTADGYTCVVYLKADGGTLVLEPDECPGSGDASWTPPGAKLTRREIDVRPGR
FT                   LVAWPNHAFKHCAGRRDVVEGEDAVAESRWLLGPFHFTPGRARLPQVGDCGSAGSYDTG
FT                   PSKPPPPPFELADIWPDHKVEWDFTPPEPLKMHRSGEAFQQKLRADLNRFAGTYKAVFE
FT                   KGEISLGDEPFKFFGLLSYQPLNLCLLPFMFIPFIGCTTVNVSPTYLESYTITLRPIGL
FT                   HTPQRNYEEDVMYGNQKSCYFGKCHGSYSEVRRRAGPMHVTGVGEAKDDKYKSVVRLTL
FT                   VEANENELRYRRKGKDATAVFDAEGSRAASLARTYPEDPEHKGIFQEWLEENKKRPFWS
FT                   DLSICEDSAPPDKRILDIDGEMVVRDGEIVLTESVDGREPFTITLKKQ"
     atgcgcctcc tggatctgtt gccgaatgac tcttggctcg cgtcgaaatc ctcggggtcg        60
     tcgtccttcg cgctcctgcg cagaccggac gaccgacccg ttccatccgt gtccgtggcg       120
     gacatgcgag cgcacatcgc gttcttgcgc gcggtgcacg tgcactcgac gcgcgacgag       180
     tcgtcgtccc tgtacgtcga cggacccccg ctccgcgcgg cggtcggcga ctacctcgcg       240
     tggctcgccg aggtgtccct cgggccttcg gccagcccgg gcccttgccc cggcgagatg       300
     ctcgtgacgc gcgcgcccac tttgcccgtc gcgtggtgct ggcacgtcca tcgcctcgac       360
     ccgcacgcgt acgtgcgcga ctgcgcctcg ctcgtgggcg cggtgccgta cccagtcccg       420
     ggcgtgggct tcgcgtcgga cgaggatcaa gtcgcatcgc ctcagcgacg gatcgaccca       480
     cccgatccag tctcgtcatc ttcccacctc gccgacatcc tcgtcgcggc gatcggccgc       540
     cacgcgccgt tcctgtggca ggtatcgggc gcggcgtata acgacgacgc gtttctcctc       600
     tccgccgcga gccgatacga ggaattcgtg gcgatgacgg tgagagcccg cggcgcgtcg       660
     ctggcgcccc cactcgacat cgacctcgcg tggcacacgc acatgcttcg cgactccgag       720
     tacctccgcg agagcgcgag gatgcgcggc gttgaactcg gcgcgatggc gcacgataac       780
     ggcgagggga tgggcgcgca cggagatacg agccggctgg aggcgccgtg ggcgaaaacc       840
     ctcgcggcgt ttcgcgaaac cgtcgacgtc tccgagacgg acggggcgac ggcgatgaag       900
     tcggcgttcg aggcggcggt tcctcgcggc gcgcgtcaca gggggtacgc gcccgcgtgg       960
     tggttcgctc gcggcgagag cgtggtggtc gtcgacgact tcctctcccc cgaagagtgc      1020
     gaggcgatcg tctcgcagat gcccggcccg gagtccgcca tgaactgccc gagcggcaaa      1080
     aaggcgcaga tgtacgtgga cggggacgcg tctgtggagg cgaggatccg cgccgccgtg      1140
     tccgtcggac tcgggttcga gggcgagccc gaggcgtcga aatcgagcct ggtgctcgag      1200
     gatatcgtca accgcgagac gggaatcggc ggaactcgat ccgatcagtt cgacccgcat      1260
     cgctcgttga ccgtggagcg caccacaccg accgtcaagc ttcccgcgcg ggtctccgtc      1320
     ggcacgatgc atccgcatcg cgatcgactc gccatctaca cgctcgaggg cgagacgatg      1380
     ttcgaggacg ataccctcac cgccgacggg tacacgtgcg tggtgtacct caaggcggac      1440
     ggcggaaccc tcgtgctgga accggacgag tgcccgggat ccggcgacgc gagctggacg      1500
     cccccgggcg cgaagctgac gcgtcgcgag atcgacgtcc ggccgggtcg gctcgtcgcg      1560
     tggcccaacc acgcgttcaa gcactgcgcg ggacgccgtg acgtcgtcga gggcgaagac      1620
     gccgtcgccg agtcgaggtg gttgctcggg ccgtttcact tcacccccgg tcgcgcgcgg      1680
     ctgccgcagg tgggcgactg cggctcggcc gggtcctacg acaccggacc atccaaaccc      1740
     cctccgccgc cgtttgagtt ggccgatatc tggcccgatc acaaggttga atgggatttc      1800
     acgccgccgg agcctctgaa aatgcaccgc tcgggcgaag cgtttcaaca aaagctgcgt      1860
     gccgacctca atcggttcgc ggggacgtac aaggccgtct tcgagaaggg ggaaatctct      1920
     ctgggcgacg aaccgttcaa attcttcggg ttgcttagtt atcagccgct caatctctgt      1980
     cttctgccct tcatgttcat cccgttcatc ggctgtacca ccgtgaatgt gtcgccgacg      2040
     tatctcgagt cctacaccat cacattaagg cctataggtc tgcatacccc tcagcgaaac      2100
     tatgaggaag atgttatgta cgggaatcag aaatcgtgtt actttggcaa gtgccacggt      2160
     agctattctg aggtgcgcag acgcgccggc cccatgcatg tgaccggggt cggtgaagcg      2220
     aaggatgata agtataagtc cgtcgtgcgt ttgacgctcg tcgaggcgaa cgagaacgag      2280
     ttgcggtaca ggcgcaaggg caaggacgcc accgccgtgt tcgacgccga aggcagccgc      2340
     gccgcatcac ttgctcgaac atatcccgag gatccggaac acaaggggat cttccaagag      2400
     tggctggaag aaaacaaaaa gaggccgttc tggtctgatc tttcgatttg tgaggattcc      2460
     gctcctcctg acaagcggat tttggatatc gacggcgaga tggtcgtgcg cgacggagag      2520
     atcgtgctca ccgagagcgt cgacgggcgc gagccgttca ccatcacgct gaaaaagcag      2580
     taa                                                                    2583
//

If you have problems or comments...

PBIL Back to PBIL home page