(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE149

MICSR_1.PE149        Location/Qualifiers
FT   CDS_pept        join(complement(293761..294679),complement(292157..293694))
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636489"
FT                   /orf_name="MICPUN_79795"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO62101.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199A828"
FT                   /db_xref="UniProtKB/TrEMBL:C1E126"
FT                   /transl_table=1
FT                   /translation="MNRDLQRLYASTPAPEANDANGGEEKAAFAPPHVVAAAAQRALAA
FT                   EGKAGGGAPSGGSGAHPAAPASRREESADAAAATHVAAIALARARRLQEAERGNRRNRR
FT                   DNRRVNNKKNRRNKSEFGDDFLEDYLPGGSKYKPGGVGNGPGDPFGPGGGDGVNTFQPV
FT                   PPRDVTLADLGGIEESLRAIRELILCPLTHPELYSWLGVDPPRGVLLHGPPGCGKTTLA
FT                   HAIAREAGVPFFSIAAPEIVAGVSGESEAKIRQLFAAAAAAAPSIVFIDEVDAIVPKRE
FT                   SAGRQMESRIVAQLLASMDNLNDGVVRGHVTVIGATNRPDGMDAALRRAGRFDREIMLG
FT                   IPDEGARARILAVQAKKLRLAGGLDLAEIAKKTPGYVGADLSALAKEAAASAVARIFQQ
FT                   LSGEESQSVVEKENVGPVEIGPEETLMGSGRLADRRPFDASELANLSITIEDFALALTK
FT                   VQPSAQREGFTTTPEVTWEDVGSLTEVREELKFSVCEPIAHPARFHAMGLAVSTGVLLY
FT                   GPPGCGKTLVAKATANEANANFISIKGPELLNKYVGESERAVRTLFARARAASPCVLFF
FT                   DELDSLAPRRGNEGNQASERVVNQLLTEMDGLEARSSTFVVAATNRPDMIDSAMLRPGR
FT                   LDKLLYVPLPPPDGRAAILKTLTRKTPLAADVDVGSIGTSARCGGFSGADLASLVREAC
FT                   VAALKGNLAAATAADAEREKIRKAGAAAGALPAPPAPPEVTLEHFEQAFERVQPSVSVA
FT                   DQKRYDELRRKLRRDVGALKPKDERPIDAGTESDMGGGAMEESGRATPSLYAGAPGGGS
FT                   GKKRKM"
     atgaacagag atcttcagag gctctacgcg tccacacccg cgcccgaggc gaacgacgcg        60
     aacggaggcg aggaaaaggc cgcgttcgcg ccgccacacg tcgtcgccgc cgcggcgcag       120
     cgcgcgctcg cggcggaggg taaggctggc ggcggagctc cttccggcgg ctccggcgct       180
     caccccgccg cgccggcgag caggagggag gagagcgcgg acgcggcggc ggccactcac       240
     gtcgcggcca tcgcgctcgc ccgcgccagg cgcctgcagg aggcggagcg cggcaacagg       300
     cgcaacagga gggacaacag gcgggtgaac aacaagaaga acaggcggaa caagtcggag       360
     tttggcgacg actttttgga ggactacctc cccggaggga gcaagtacaa gcccggcggc       420
     gtcggcaacg gcccggggga tcccttcggc ccggggggcg gcgacggcgt gaacaccttc       480
     cagcccgtcc ctccgcggga cgtcacgctc gcggacctcg gcggcatcga ggaatccctg       540
     agggcgattc gcgagctcat cctgtgcccg ctgacgcacc ccgaactcta ctcgtggctc       600
     ggcgttgacc ccccccgcgg cgttttgctg cacggtcccc cgggctgcgg caagaccacc       660
     ctcgcgcacg ccatcgccag ggaggccggg gtgcccttct tctccatcgc cgccccggag       720
     attgtcgcgg gcgtctcggg cgagtccgag gctaagatcc ggcagctctt cgcggcggcg       780
     gcggcggcgg cgccgtcaat cgtcttcatc gacgaggtcg acgccatcgt ccccaaacgc       840
     gagagcgccg ggcggcagat ggagagcagg atcgtggcgc agctgctcgc gtcgatggat       900
     aatctcaacg acggggttgt gcggggtcac gtcaccgtca tcggagccac caaccgaccg       960
     gacggcatgg acgccgcgct gcgccgcgcg ggccggttcg atcgcgagat catgctgggg      1020
     atccccgacg agggcgcgcg ggcgaggata ctggccgttc aggctaagaa gctgcgttta      1080
     gccggcgggt tggacctggc ggagattgcg aaaaagacgc cagggtacgt cggagccgat      1140
     ctgagcgccc tggcgaagga ggctgccgcc tccgcggtgg ctcgcatctt ccagcaactc      1200
     tccggcgagg agagccagag cgtggtggaa aaggaaaacg tgggtccagt tgagattggt      1260
     cccgaggaga cgctgatggg gtcgggtcga ctggcggatc ggcgaccgtt cgacgcctcc      1320
     gaactggcga acctctccat aaccatcgag gactttgcgc tcgcgctgac caaggtgcag      1380
     ccctcggcgc agcgcgaggg gttcaccacg acgccggagg tgacctggga ggacgtcggg      1440
     tccctgacgg aggttcgcga ggagctcaaa ttttccgtgt gcgagcccat agcgcacccg      1500
     gcgcggtttc acgctatggg cctggctgtg tccacgggcg tcttgctcta cggtcccccg      1560
     ggctgcggca agacgttggt ggccaaggcc acggcgaacg aggccaacgc caacttcatc      1620
     agcatcaagg gacccgagct gctgaacaag tacgtgggcg agtcggagcg cgcggttcga      1680
     acgctgttcg ccagggcgag agccgcgtcg ccctgcgttt tgttcttcga cgagctcgac      1740
     tcgctcgcgc cccggcgcgg gaacgagggg aaccaggcgt ccgaacgcgt cgtgaaccag      1800
     ctgctgaccg agatggacgg actggaggct cgctcgtcca cgttcgtcgt cgccgccacg      1860
     aacaggccgg acatgatcga ttcggcgatg ctccggccgg ggcggctcga caagctcctc      1920
     tacgtgccgc tgcccccgcc ggatggccgc gccgccatcc tcaagacgct cacgcggaag      1980
     acgccgctgg ccgccgacgt ggacgtgggc tcgataggca cgtcggcgag atgcggcggg      2040
     ttctcgggcg cggacctggc cagcctggtg cgcgaggcgt gcgtcgcggc gctcaagggt      2100
     aacctcgcgg ccgcgacggc ggcggatgcg gaacgggaga agattagaaa ggcgggcgcc      2160
     gccgcgggcg cgctcccggc gccgcccgcg ccgcccgagg tgaccctgga gcacttcgag      2220
     caggcgttcg agcgcgtgca gccgtcggtg agcgtcgcgg atcagaagcg gtacgacgag      2280
     ctccggcgca agttgcgaag agacgtgggc gcgctcaagc ccaaggatga gcgcccgatc      2340
     gatgccggga cggagagcga catgggcgga ggcgcgatgg aggaatcggg gcgcgcgacg      2400
     ccgtccctgt acgcgggagc tccaggggga ggctcgggga agaagcggaa gatgtga         2457
//

If you have problems or comments...

PBIL Back to PBIL home page