(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE15

MICSR_1.PE15         Location/Qualifiers
FT   CDS_pept        complement(28735..31185)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636020"
FT                   /orf_name="MICPUN_56586"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62036.1"
FT                   /db_xref="UniParc:UPI000199AAB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P2"
FT                   /transl_table=1
FT                   /translation="MKGQQNGAGDGSVGNQPPAGYLQRLWAWLRRPQARGKTNHHIRRS
FT                   RRLSHFATLKTMPELADVPSKCISSPAYRSGSAWEMEYAGKDMMTLLGDAMKSSCSPSD
FT                   LRNAALVCKEWRSMLGYAPAVASILRGGDAFAIAKMLAAKDIESVVQHHISDFVRVLAR
FT                   TAETEEDDTFLATSVADLGNIWMFAFKLSWNSHAEQMIEAWLKVFVTRVREMHLMCSDG
FT                   DPINAAITCIGPVDRNDADVDARLVLHMDLRQTVRRIGEALVPRLGDIIDRASRRLNNI
FT                   MQSLNNLWLHRFHDFIGSPSHVDPSESFATREAVEVDIDNLVAYSLVIRAVFLEFPREA
FT                   SVHLRSLLPLLSIEFDEVQGYLLFEFGVQNAFIGIREKYLSPGGRYATYVKTMQENFSV
FT                   VINITDALLAMQKVVKNGWEPDGLHDALLQALLGSSGDKKLELVRAFPTVAARNLSWLY
FT                   EAITLPDDYVHDEEAGRDADVWDHIEAGVNLVCCLLDTEVQFDGNLIMDRLVRLVPFDR
FT                   GPELLWAINELVRRELTDLRPDAHVIADVLDRPNYMKTRDQAITAFGLLGDEAEPHLDR
FT                   FMEQMKEVLVQETGDRFVQTLYEHRYRLKQNHLRDIILCLNESDWIPEIVTALETVRVL
FT                   CKTEEDATQIMYTMFYEMLDLTSEIDDDGQSYFPCNGGNYLFEAIQYVALRVDEPTRRE
FT                   ILQYLRANSKGPSSQNPYRWLSMLHIRAMIEKDVSPALALDHMLEMYDNNDGDRRRRDD
FT                   IVDYKVEQLEIFNEGRRKLRSEYCDRLAELRLQAEDAFDFLSSSDEEDADDDRDSTGSE
FT                   DIEF"
     atgaagggcc agcaaaacgg cgcgggggat ggatctgtcg gaaaccaacc gcccgcgggg        60
     tatcttcaaa gattgtgggc gtggctgcga cggccgcaag cgagaggaaa aactaatcac       120
     cacataagga ggtcgagacg cctgagccac tttgcgacct tgaagacgat gcccgagcta       180
     gctgatgttc cttccaagtg tatatcctcc ccagcgtatc gttctggttc tgcctgggag       240
     atggagtacg cggggaaaga catgatgacg ctccttgggg acgccatgaa gtcatcgtgc       300
     tcaccgagtg atttgagaaa cgccgcgttg gtgtgcaagg agtggcgctc aatgctggga       360
     tacgcccccg cggtggcgtc gatcctcaga ggaggtgacg cttttgcaat cgcgaaaatg       420
     ttggctgcga aagacatcga atctgtagtc cagcaccaca tctccgactt tgtccgggtt       480
     ttggcgagaa ccgcagagac tgaagaagac gacacgtttc ttgcgacatc cgttgcagat       540
     cttggcaaca tctggatgtt tgccttcaag ctatcgtgga atagccacgc ggaacaaatg       600
     atagaagcgt ggctcaaggt tttcgtcaca cgtgtgcgtg agatgcatct gatgtgttcc       660
     gatggagatc ctataaatgc tgcgattacc tgcatcggtc ctgtcgatcg aaacgacgca       720
     gacgtagacg cgaggctcgt tctacacatg gatttgaggc agaccgtgag gcgtatcggt       780
     gaagcgttgg tgcctcgcct cggtgacatt atcgaccgag cctcgagacg gctgaacaac       840
     atcatgcagt ctttgaacaa cctatggctt catcgatttc atgacttcat cgggtcaccg       900
     tcccatgtcg atccttcaga gtccttcgca acccgcgaag ctgtcgaagt ggacatagac       960
     aatctggtgg cgtactcttt ggttatccgt gccgtcttcc tggaatttcc gcgggaggcg      1020
     agcgtccatt tgcgcagtct gctacccttg ctctctatcg agtttgatga ggtgcaaggc      1080
     tatcttcttt ttgagtttgg cgtacaaaac gcgttcatag gtattcgaga aaaatacctt      1140
     tcgccggggg ggaggtacgc aacttacgtt aaaaccatgc aagaaaactt cagcgtcgtt      1200
     atcaacatca cggatgccct cctggccatg caaaaagttg tgaaaaatgg gtgggagcct      1260
     gatggcctgc atgatgcttt gcttcaagcg ttactgggca gctcaggaga taaaaaactc      1320
     gaacttgtgc gcgcatttcc aaccgtcgcg gcaagaaatc tctcctggtt gtatgaagca      1380
     attacactcc ctgatgacta tgttcatgac gaagaagcag gacgtgacgc tgacgtatgg      1440
     gaccatattg aagctggtgt gaatctcgtg tgttgtctgc ttgacaccga agtgcaattc      1500
     gatggcaacc tgatcatgga cagactggtc cgtctcgtcc catttgaccg aggccctgaa      1560
     ctgctctggg cgataaatga gcttgtgcgc agagagctca cagacctgag gcctgatgca      1620
     catgtgatcg ccgatgtact tgaccgccct aattacatga aaactcgtga ccaggcgata      1680
     actgcgttcg gcttgctcgg cgacgaggct gaaccccatt tggatcgctt catggagcag      1740
     atgaaagaag tcttagttca ggaaacagga gacaggtttg ttcagacttt gtatgaacac      1800
     cggtatcgcc taaagcaaaa tcatctgcga gacatcatcc tttgcttaaa cgagagcgat      1860
     tggattccag agattgtcac ggcgctcgaa acggtgcggg ttctgtgcaa gacagaggag      1920
     gatgccactc agataatgta caccatgttc tatgagatgc tcgatttgac gtcggagatt      1980
     gacgatgacg gtcaatctta cttcccgtgc aatggcggca actacctctt tgaggcaatt      2040
     cagtacgtag ccttgcgtgt tgacgaaccg actcgacgtg aaatacttca gtatttgcgc      2100
     gcaaattcca aaggtccgag ttctcagaac ccatatcgtt ggctcagcat gttgcatatt      2160
     cgtgcgatga tcgaaaagga tgtgtcaccg gcattggcgt tggatcacat gttggagatg      2220
     tacgacaaca acgatggcga ccggcgccgt cgcgatgaca tcgttgatta caaggttgaa      2280
     cagttggaga tattcaatga aggccgtcgg aagctaagaa gtgaatattg tgatcggctc      2340
     gctgaactgc gcttgcaagc tgaggacgct ttcgacttct tatcctcttc cgatgaagag      2400
     gacgccgacg acgacaggga ctctacagga tcagaggaca ttgaattttg a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page