(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE150

MICSR_1.PE150        Location/Qualifiers
FT   CDS_pept        complement(295336..297216)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636490"
FT                   /orf_name="MICPUN_56723"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62102.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniParc:UPI000199A899"
FT                   /db_xref="UniProtKB/TrEMBL:C1E127"
FT                   /transl_table=1
FT                   /translation="MWAARAAHRGARRVAQRTESLSVASALRSNLPSRSTTSGSIVTAS
FT                   SSRVRSFVGPSRHVSFAPPNPIIPAAYVAGSIASRTVLATARMNAANRVFNAVTTPSAR
FT                   ARLRDALLGRTRSGSVTRVAVVATGAGVVAHVYTEEVPATGRRRLMLLDLGDEERLLRA
FT                   ATAAQFERLDGSFLPPSHPATQRVAGILWKLVNRLDPALVVGTNPKNLSHHPLLAEGAT
FT                   WSLHVYDSPEVNASVAPGGHIFVSTGLIRACGRDDGRLAFVLAHEMGHRIARHVAEHAS
FT                   IEMLRTMGVAVGWALAAMFGADFLGGAVTASAMVGAEAAAELAVSLPYSRTMEYEADEI
FT                   GMRLLTGACFDPDAGPRMMSTLEAFAVEQRRLAERESSSTRDGSFNGVQRRSTSFNGDD
FT                   ERARKEMERYLSTHPLNEERIAAMRERIMPRLFESASNSDCGAYVAALQSSMGLRHRRL
FT                   PPNAHDANKGKVFIPTSKWRARYVRELDVTHSTERGMNRVLDRRNKMSSTDAANAGDHG
FT                   AMTGPLGRFDDRRMRALLARPDTEAGAKAREDAAALGSKGMHSRGWRGPVRRKVELSKA
FT                   SASDGVEASPGVRDEASRGDAEEGTELGELVGMYWSGSGARRAVRRAAAA"
     atgtgggctg ctcgcgcggc ccatcggggc gcccggcgcg tcgctcaacg caccgagagc        60
     ctttcggtcg cgtccgcgct ccgttcgaac ctcccttctc gctcgacgac gtccggctcg       120
     atcgtcacgg cgtcgtcatc gcgcgttcgc tccttcgttg ggccctcgcg ccatgtgtcc       180
     ttcgcgccgc ccaaccccat catccccgcc gcttacgtcg cggggtccat cgcgagtcgc       240
     accgtgctgg ccaccgcgag gatgaacgcc gccaacaggg tgttcaacgc cgtcaccacc       300
     ccgtccgcga gggcccgact gcgcgacgcc ctcctcggtc gcacgcgatc gggatcggtc       360
     actcgcgtcg cggtcgtcgc cacgggcgca ggggtcgtcg cgcacgtcta caccgaggag       420
     gtacccgcga cggggcgacg taggctcatg ctcctcgacc tcggcgacga ggagcggctc       480
     ctgcgcgccg ccaccgcggc gcagttcgag cgcctggatg gatcgttcct gcccccgtcg       540
     caccccgcga cgcagcgcgt ggcggggatc ctgtggaagc tggtgaaccg actcgacccg       600
     gcgttggtcg tggggacgaa ccctaaaaac ctctcgcatc acccgctgct cgcggagggt       660
     gccacgtgga gcctccacgt gtacgattcc cccgaggtga acgcgtcggt ggcgcccgga       720
     ggccacatct tcgtgagcac cggcttgatc cgcgcgtgcg ggagggacga cggacgactg       780
     gcgttcgtgt tggcgcacga gatgggacac aggatcgcgc ggcacgtcgc ggagcacgcg       840
     tcgatcgaga tgttgagaac gatgggcgtc gccgtcgggt gggcgctggc ggcgatgttc       900
     ggtgcggatt tcttgggcgg cgcggtgacg gcgtcggcga tggtgggcgc ggaggctgcg       960
     gcggagctgg cggtgagtct gccgtacagc aggacgatgg agtacgaagc ggacgagatc      1020
     ggcatgcggt tgctcaccgg cgcttgcttc gatcccgacg cggggccgag gatgatgtcc      1080
     acgttggagg cgtttgccgt cgagcaacgg cggctggcgg agcgggagtc gagctcgacg      1140
     cgagacggat cgttcaacgg cgttcaacgg cgttcaacat cgttcaacgg cgacgacgaa      1200
     cgcgcacgca aggagatgga gcggtacctg agcacgcacc cgctcaacga ggaacggata      1260
     gcggccatgc gcgagcgcat catgccgcgg ctattcgaat cggcgtcaaa ctctgactgc      1320
     ggcgcgtacg tcgccgcgct tcaaagttcg atgggattac gccaccgccg tctgccgccc      1380
     aacgcgcacg acgcgaacaa gggtaaagtt ttcatcccga cgtccaagtg gcgggctcgg      1440
     tacgtgcgcg agctggacgt gacgcactcg accgagcggg gaatgaaccg ggtgttggat      1500
     cggaggaata aaatgtcgtc gacggatgcg gcaaacgccg gggaccacgg cgcgatgacg      1560
     ggtccgttgg gaagattcga cgaccgcagg atgcgcgcgt tgctggcgag gccggacacg      1620
     gaggctggag cgaaggcgcg cgaggacgcc gccgcgctcg ggtccaaggg catgcacagc      1680
     aggggttggc gtggtccggt gaggaggaag gttgagctgt cgaaggcgtc cgcctcggac      1740
     ggggtcgagg cgtcccccgg ggtacgagac gaagcgtcgc gcggggacgc ggaggaaggg      1800
     acggagctcg gcgaactagt cgggatgtac tggtcggggt ctggggcgag acgggcggtc      1860
     cgcagagcgg cggcggcgta g                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page