(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE151

MICSR_1.PE151        Location/Qualifiers
FT   CDS_pept        297318..299243
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636491"
FT                   /orf_name="MICPUN_56724"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61661.1"
FT                   /db_xref="UniParc:UPI000199A89A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E128"
FT                   /transl_table=1
FT                   /translation="METPSREVSDAGSAARRNPRSPGVSLGRGLDSFLDDLTPEATRQA
FT                   TTEDRAALLQLTKFRERLAAMGDGAGDGDEHDPPATPSDSPRTMDTTSRASSPPSPDEN
FT                   APPGTGIPGMTPRKVHPSFTLPPHEQQRRDAAAAAAVRTRGTSPSLITSPSGRIEVGAT
FT                   ATTTARSSPLGREPTTPTDLDDAGGSQRRRRARVLEDGTDVFGRDDDDVFGRDNDDGDG
FT                   LTETRGSAAADTTARPPADDPRSLATRSNDDPRIVGRLLGSVEAALAEAVTPRAALGAL
FT                   RADVDECRAAIDALRESHVALEREDGALTEAQGQMREELDDAWRTRLPRLERLMFRLAD
FT                   RLDRVVDEAVAASEAVNVRRLEEELGRLRVEIAETIASIGDGTGEAVGEATLEAIAHVD
FT                   SSVNALRAETAAAVESVRVETLARLERMEAAQLAEEARRKSAVESAVESTRGSRHWSSF
FT                   AAGLEPCVDVITALAARVLGPGRRSGKDERESYPAVTATGSALDDEASGVINRGLRRQI
FT                   HRCKTIGGVEGVAWDDDAGADLLGASLVVLAAEAAHAIAPRGPCRVATRVVRAAVWTST
FT                   AALASGAVKSWCHRVANEAMAERRRRLEGGAKEGADVDDDDEEEERFETPPARSSADPE
FT                   LFVDTH"
     atggagacgc cgtcacggga ggtatcggac gcgggttccg ccgcgaggcg gaatccgcgc        60
     agtcccgggg tgagcctcgg ccgcggcctg gactcgtttc tcgacgatct caccccggag       120
     gcgacgcggc aggcgacgac cgaggaccgc gccgcgctgc tgcagctgac caagttcagg       180
     gagcggctcg cggccatggg cgacggcgcg ggcgacggtg acgagcacga tcccccggcg       240
     acgccctcgg acagcccgcg gacgatggat accaccagcc gcgcgtcgtc tccgccatcg       300
     ccggacgaga acgcgccgcc gggcacgggc atcccgggca tgacccctcg gaaggttcac       360
     ccgtcgttca cgctcccgcc ccacgagcag cagcggcgcg acgccgccgc cgccgccgcc       420
     gtccgcaccc ggggcacgtc tccgagcctg atcacgtccc cgtcgggtcg gatcgaggtc       480
     ggcgcgacgg cgacgacgac cgcgcgttcc tcgccgctgg gccgcgaacc gaccaccccg       540
     acggacctag acgacgccgg ggggagtcaa cggaggcgcc gggcgcgtgt tctcgaagac       600
     ggaacagacg ttttcggcag ggacgacgac gacgttttcg gcagggacaa cgacgacggc       660
     gacgggctca ccgagacgcg cgggtccgcc gccgccgata ccacggcgcg gccgccggct       720
     gacgacccgc gctcgttagc gactcggtca aacgacgatc cacgcatcgt cgggcggctg       780
     ctgggatccg tggaggcggc gttggcggag gcggtgacgc cgcgagcggc gctgggtgcc       840
     ctgcgcgcgg acgtggacga gtgcagggcc gcgatcgacg cccttcgcga gagccacgtc       900
     gcgctcgaac gcgaggacgg cgcgttgacc gaggcgcagg gtcagatgcg ggaggagctc       960
     gacgacgcgt ggagaacgcg gctgccgcgg ctggagcgcc tgatgttccg actcgccgat      1020
     cgcctggacc gcgtggtgga cgaggcggtg gcggcgtcgg aggcggtgaa cgtgcgacgc      1080
     ctcgaggagg agctgggtcg gcttcgcgtt gaaatcgccg agacaatcgc gagcatcggc      1140
     gatggcacgg gtgaagccgt cggcgaggcg accctcgaag ccatcgcgca cgtggactcc      1200
     agcgtgaacg ccctgcgcgc cgagaccgcg gccgcggtgg agagcgttcg cgtcgagacg      1260
     ctggcgcggt tggagcggat ggaggcggca cagctggcgg aggaggctcg gcgaaagagc      1320
     gccgtcgaga gcgccgtcga gagcactcgc ggatcccgtc attggagctc cttcgccgcg      1380
     ggtttggagc cgtgcgtcga cgtgatcacc gccctcgcgg cccgcgtgct cggaccgggg      1440
     cgtcgttcgg gcaaggacga acgcgagagc tacccggcgg tgacggcgac gggatccgct      1500
     ctcgacgacg aagcgtccgg ggtgataaac cgtgggctcc gacggcaaat ccatcgatgc      1560
     aaaaccatcg gaggcgtcga aggcgtcgcc tgggacgacg acgcgggcgc ggacctgctc      1620
     ggcgcgtcgc tcgtcgtcct cgccgccgag gcggcgcacg cgatcgcgcc gcgcggtccg      1680
     tgcagggtgg cgacgcgggt cgtgcgcgcg gcggtgtgga cgagcacggc ggcgctggcg      1740
     tcgggcgcgg tgaaatcgtg gtgccaccgc gtggcaaacg aggcgatggc ggagcgaagg      1800
     aggcggctcg aagggggtgc gaaggagggc gcggacgtcg atgacgatga cgaggaggag      1860
     gagaggttcg agactccgcc ggcgaggtcc tcggcagatc ccgagctgtt cgtcgacacg      1920
     cactga                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page