(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE152

MICSR_1.PE152        Location/Qualifiers
FT   CDS_pept        299356..300531
FT                   /codon_start=1
FT                   /gene_family="HOG000250278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636492"
FT                   /orf_name="MICPUN_56725"
FT                   /product="Aryl-alcohol dehydrogenase related protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61662.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199A89B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E129"
FT                   /transl_table=1
FT                   /translation="MKPATVLSSSVAPVGVSRSRAAPRRAAVAARASTDAAATTPAAGV
FT                   GNTFRTATDRVTLGTSDLSVAATGAGAWAWGDRSGYWGSDWEGDRAKNLDAYMTLLAGG
FT                   VDFIDTAEVYGFGKSEELIREFMRDTAADATLAPPLLATKFAPIPFRFRAEDVPNALRA
FT                   SMARMGVRKVALYMQHWPAFGLPGVTEACNDAFLEGLCLCYERGLCRAVGVSNFNAERV
FT                   KRAAKKFKERGVPFASNQIQYSLAYRAPETDTGVIDACVECGVTPVAYSPMAQGLLTGK
FT                   YSAASPLGEGVKATGPRARILSEEKLASADALVDLMREIGRNHGGVTPAQIAVNYCMTK
FT                   GTVPIPGAKDARQAEAVVGCLGWRLDEAEVAELEAAAALVPSTPGAPFERW"
     atgaagcccg ccaccgtcct ctcctcctcc gtcgcgcccg tcggcgtatc gcgttcgcgc        60
     gccgcgcctc gtcgcgccgc ggtggccgct cgcgcctcca cggacgccgc cgcgacgacc       120
     cccgccgcgg gcgtcggcaa cacgttcagg accgccacgg atcgagtgac gctcggcacg       180
     agcgacctct ccgtcgcggc caccggcgcg ggcgcgtggg cgtggggcga ccgcagcggc       240
     tactggggct ccgactggga gggcgaccgc gccaagaacc tcgacgccta catgacgcta       300
     ctcgcgggag gcgtcgactt catcgacacc gccgaggtgt acggcttcgg caagtcggag       360
     gagctcatcc gcgagttcat gagggacaca gccgcggacg ccacgctcgc accgccgctc       420
     ctcgccacca agttcgcgcc gatccccttc cgcttccgcg ccgaggacgt ccccaacgcg       480
     ctcagggcgt ccatggcccg catgggcgtc aggaaggtgg cgctctacat gcagcactgg       540
     cccgcgtttg gacttccggg cgtcaccgag gcgtgcaacg acgcgttcct cgagggcctc       600
     tgcctgtgct acgagcgagg cctgtgccgc gcggtgggcg tctcaaactt caacgccgag       660
     cgcgtcaaac gcgcggcgaa gaagtttaag gaacgcggcg tgccgttcgc gtccaaccag       720
     atccagtact ctttggcgta ccgagcgcca gagacggaca ccggcgtcat tgacgcgtgt       780
     gtcgaatgcg gcgtcacccc ggtggcctac tctccgatgg cgcaggggct gctcacgggt       840
     aagtactccg ccgccagccc gctcggcgag ggagtcaagg cgacgggacc gagggcgagg       900
     atcctcagcg aggaaaagct ggcgtccgcg gatgcgctcg tcgacctgat gagggagatc       960
     gggcgcaacc acggcggcgt cacccccgcg cagatcgcgg tgaactactg catgaccaag      1020
     ggcacggtgc ccatcccggg cgcgaaggac gccaggcagg cggaggctgt cgtcggttgc      1080
     ctcgggtgga ggctcgatga ggccgaggtg gccgagttgg aggcggcggc ggcgttggtg      1140
     ccgtcgacgc ccggcgctcc gtttgagagg tggtga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page