(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE153

MICSR_1.PE153        Location/Qualifiers
FT   CDS_pept        join(300990..301088,301244..301690)
FT                   /codon_start=1
FT                   /gene_family="HOG000163282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636493"
FT                   /orf_name="MICPUN_105248"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61663.1"
FT                   /db_xref="HOGENOM:HBG609692"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniParc:UPI000199A89C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E130"
FT                   /transl_table=1
FT                   /translation="MDAKWRLDFADASTSGNNAPVNPPGYASLRELGDVDAPAKGKADA
FT                   PKGGVVAPGGALTSAARQQKAYQFAMSQVQAIGMTGFMMYMAGSGVQIFSMMVVGNGLF
FT                   QPIKAIASSGKIFEPYADASTDVTGPRALFCAIQLAGLAMALYKLNSMGLLPTHASDWV
FT                   SGMKPPTPVEHAYGGTTL"
     atggacgcga agtggcgact agatttcgcc gacgcgagca cgtccgggaa caacgcaccg        60
     gtgaacccac cggggtacgc gtcgctgcga gagctcgggg acgtcgatgc ccccgcgaag       120
     ggcaaggcgg acgcgcccaa gggcggcgtc gtcgcgcccg gcggcgcgct gacttccgcg       180
     gcgcgccagc agaaggcgta ccagtttgcc atgtcgcagg tgcaggcgat cgggatgacg       240
     gggttcatga tgtacatggc cgggagcggc gtgcagatct tctccatgat ggtcgtgggt       300
     aacggcctgt tccagcccat caaggccata gcgtcgagcg gtaagatctt cgagccgtac       360
     gcggatgcga gcacggacgt gacgggcccg cgggcgctgt tttgcgccat ccagctcgcc       420
     gggctcgcga tggcgctgta caagctgaac agcatgggcc tgctacccac gcacgcgagc       480
     gactgggtca gcgggatgaa gcctcccacg ccggtggagc acgcgtacgg agggaccacg       540
     ctgtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page