(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE154

MICSR_1.PE154        Location/Qualifiers
FT   CDS_pept        301973..302530
FT                   /codon_start=1
FT                   /gene_family="HOG000100022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636494"
FT                   /orf_name="MICPUN_99323"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61664.1"
FT                   /db_xref="HOGENOM:HBG560012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A89D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E131"
FT                   /transl_table=1
FT                   /translation="MRYIPHKRGKPSRWVREAAGNDDVEGIDAALDAASNKDEALNKGD
FT                   IMGRTALHWAAGRGRVDAVRHLLALGARVKISGMHHTPLHDLAESGAAAAPTLVQELVE
FT                   AAPWQLTYKDNTGAMPVDRAKSAGQRQMVRALESAAMMVTGAERAMMSRHTHSFLPSCL
FT                   SVATISLDSPGSSVTRPLLEGA"
     atgaggtaca tcccccacaa gagaggcaaa ccctcgcgct gggtgcgcga ggctgccgga        60
     aacgacgacg tcgagggcat cgacgccgcg ctcgacgcgg cgagcaacaa ggacgaagct       120
     ttgaacaagg gcgatattat gggcaggacc gctctccact gggcggcggg acggggccgg       180
     gtcgatgcgg tgcgccacct cctcgctctc ggggccaggg tcaagatctc cggcatgcac       240
     cacaccccgc tccacgacct cgcggagagc ggcgcggctg ccgcgccgac gctcgtgcag       300
     gaactcgtgg aggccgcgcc ctggcagctc acgtacaagg acaacaccgg cgccatgcct       360
     gtggacaggg cgaaaagcgc ggggcagcgc cagatggttc gcgcgctcga gtccgccgcc       420
     atgatggtca ccggcgcgga gcgcgcgatg atgagtcgcc acacgcactc gttcctgcct       480
     tcgtgcctgt ccgtcgcgac gatcagcctc gactcgcccg gtagcagcgt caccaggccg       540
     ctgctggagg gggcgtga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page