(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE155

MICSR_1.PE155        Location/Qualifiers
FT   CDS_pept        302802..303365
FT                   /codon_start=1
FT                   /gene_family="HOG000100022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636495"
FT                   /orf_name="MICPUN_56728"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61665.1"
FT                   /db_xref="HOGENOM:HBG560012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A89E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E132"
FT                   /transl_table=1
FT                   /translation="MSYARPKRGKPERWVREAAGNDDVEGIDAALDAAKDRERLLNKGD
FT                   FVGRTALHWAAGRGRADAVRHLLALGARVKLSGNQASPLHDLAASGSPNAPALVQDLLA
FT                   AAPWQLTHRDNMGHYPVDKARDVGDKSMALALDALMMTVVGKRGPTAKPRTPSSWMPSC
FT                   MSAGKARGIVGSDERPLLEGAARA"
     atgagttacg ctcgccctaa acggggtaaa cccgagcgct gggtgcgcga ggctgccggc        60
     aacgacgacg tcgagggcat cgacgccgcg ctcgacgccg cgaaagacag ggaacggctt       120
     ctgaacaagg gggacttcgt cggcaggacc gctctccact gggcagcggg acggggccgg       180
     gccgacgcgg tgcgccacct cctcgcgctc ggggccaggg tcaagctctc cggcaaccag       240
     gcgagcccgc tccacgacct ggcggcgagc ggctcgccca acgcgccggc gctcgtgcag       300
     gatctcctcg ctgccgcgcc ctggcagctc acgcaccgcg ataacatggg tcactacccc       360
     gtcgacaagg cgagggacgt gggtgacaaa tccatggcgc tcgcgctcga cgcgttgatg       420
     atgacggtcg tcggcaagcg cggaccgacc gctaaacccc gcactcccag ctcgtggatg       480
     ccgtcgtgca tgtccgcggg gaaagcgcgc ggaatcgtgg gaagcgacga gaggccgctg       540
     ctggaagggg cggcacgcgc gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page