(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE156

MICSR_1.PE156        Location/Qualifiers
FT   CDS_pept        303500..305074
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636496"
FT                   /orf_name="MICPUN_56729"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61666.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000199A89F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E133"
FT                   /transl_table=1
FT                   /translation="MGALEDLVASHLGGFSPEGGVHLPNTPGYDACLLSAGAANYACLH
FT                   ERRRPPVALQPARESDVVLAVRFVTAGIERGLWPEGGRVDGSPDGGDGVPLTLCGGGHS
FT                   ELCVRHGAVLIHFGRMASVSCDPAAGTVTIAPGALLGAMNEAAQNHGLAVPTGVFAGVG
FT                   VGSILAGGIGRLARARGLSVHSVVAMRVVTADGEIHVLGEGTHMDGLARDMWWGCRGAA
FT                   AALGVVTSVTLRAAPIAPTVSHGRRIYPTFADAPDAAARLRRIETIARALPEATQVDVC
FT                   VTRAAGGGGGGVRIGVFPCATDGGDVPADVVASLELTPRHVTRSRYCDVPYHSMLPDDE
FT                   LDDESAPGDDESAPGDDGTPSQATPGMFSYVRQWFVDELGEIGAAAVAAAAAAAPTDDS
FT                   LVMMQHAGGAVRRGGRPADDDDAPADDDLSFPHRQWEWSVVIIALWTDPSSRARTTAEA
FT                   WADDAFESLRGCGVGCYAVDIDRFRRSGADAEEEVKLAFGEVNAARLRELKRRVDPMNV
FT                   FAAAVPL"
     atgggagccc tcgaagacct cgtcgcgtcg catctcgggg gtttcagccc cgagggcggc        60
     gttcacctcc caaacacgcc cggatacgac gcgtgcctgc tctccgcggg cgcggccaat       120
     tacgcgtgcc tccacgagcg aaggcgacct ccggtggcgc tccagcccgc gcgcgagagc       180
     gacgtcgtgc tggcggttcg cttcgtcacc gcggggatcg agcgcggtct ctggcccgag       240
     ggagggaggg tggacgggtc cccggacggg ggcgacggcg tgcccctcac gctgtgcggc       300
     ggagggcact ccgagctgtg cgtgcgccac ggcgcggtcc tcatccactt cggccggatg       360
     gcttccgtgt cgtgcgaccc ggcggcgggg acggtgacga tcgccccggg cgcgctcctc       420
     ggggcgatga acgaggccgc gcaaaatcac ggcctcgcgg tgcccaccgg agtcttcgcg       480
     ggcgtcggcg tgggatcgat cctggcggga ggcatcggac gcctcgcgcg cgcccggggg       540
     ctctccgtcc acagcgtcgt cgccatgcga gtcgtcaccg ccgacggcga aatccacgtc       600
     ctgggcgagg gcacgcacat ggacgggctc gcgagggaca tgtggtgggg atgtcgcggc       660
     gccgccgccg cgctcggcgt cgtcaccagc gtcacgctca gagccgcgcc catcgcgccc       720
     accgtctccc acggccgacg gatctacccg accttcgccg acgcccccga cgccgccgcg       780
     cgcctacgac gaatcgaaac gatcgcccgc gcgcttcccg aggcgacgca ggtggacgtg       840
     tgcgtgaccc gagcggcggg cggcggcggc ggcggggtca ggatcggcgt gtttccctgc       900
     gcgacggacg gcggcgacgt ccccgccgac gtagtcgcga gcctcgagtt gacgccccgg       960
     cacgtgacgc gttcgaggta ctgcgacgtt ccctaccaca gcatgcttcc ggatgacgag      1020
     ttggacgacg agtcggcacc cggggacgac gagtcggcac ccggggacga cgggacgccg      1080
     tcccaggcga ctcccgggat gttctcctac gtgcgccagt ggtttgtgga tgagctcggc      1140
     gagatcggcg ccgccgccgt cgccgccgcc gccgccgccg cgcccaccga cgactcgctc      1200
     gtcatgatgc agcacgcggg aggcgcggtg cggcggggcg ggaggcccgc ggacgacgac      1260
     gacgcccccg ccgacgacga tctctcgttt ccgcatcgtc agtgggagtg gagcgtggtg      1320
     atcatcgcgc tgtggacgga cccgagttcg cgcgcgcgga cgacggcgga ggcttgggcc      1380
     gacgacgcct tcgagtcgct caggggatgc ggggtggggt gctacgcggt ggacatcgac      1440
     aggttccgac ggtcgggggc tgacgcggag gaggaggtga agctcgcgtt tggcgaggtc      1500
     aacgcggcgc ggctgaggga gctgaagcgg cgggtcgacc cgatgaacgt ctttgccgcg      1560
     gcggttccgc tgtga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page