(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE158

MICSR_1.PE158        Location/Qualifiers
FT   CDS_pept        307809..308090
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636498"
FT                   /orf_name="MICPUN_56731"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61667.1"
FT                   /db_xref="UniParc:UPI000199A8A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E135"
FT                   /transl_table=1
FT                   /translation="MRKETAFLLVICYVAFHLSQLSLEDLVAHLESGKQIVAGVLADPI
FT                   GKGQEYYDRLVQTGAAKFLAFAAASKLISWHFKRSATSRKIAADKKAK"
     atgagaaagg agaccgcctt tctcctcgtc atctgctacg tcgcctttca cctctcgcag        60
     ttatcgctcg aggatctcgt cgcgcacctt gagagcggca agcagatcgt cgctggcgtg       120
     cttgccgatc cgattgggaa aggccaggag tactacgaca gactcgtcca gaccggcgcg       180
     gccaagttcc tagccttcgc cgccgcgtcc aagctcatct cctggcactt caagcgctcg       240
     gccacgtcga ggaaaatcgc ggccgacaag aaggccaagt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page