(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE16

MICSR_1.PE16         Location/Qualifiers
FT   CDS_pept        31431..32483
FT                   /codon_start=1
FT                   /gene_family="HOG000100015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636021"
FT                   /orf_name="MICPUN_107848"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61592.1"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199AAB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P3"
FT                   /transl_table=1
FT                   /translation="MWIRPAILGAQPSGRGGCASATVGDMCLFIGGTDRSPRAFDEVWI
FT                   LKMAPESTDGVSSSDWRWIRKSTTVRGGGTLPARTGATATAVGRKVYVFGGQEPSRGTC
FT                   FNDVVVLDCDSWEWSRLEISGPSPPPRNSHVACVVNGGRLLVVYGGSSPEVGPMSDVYL
FT                   LDLEEGAERWIRPKVTGQAPEPREMHAACVLPNTPGDGDWNGDREIIVVGGRGGASVLS
FT                   DAVVLDAQRLEWVRRGDVGVAVCAHTAVPWRLGRSGAALLFGGFGGAALRGNDTVTVDG
FT                   TTLKTIVKGVSSEDVAFAPEPRFAHSSCLVPGGGMLVFAGVTPEADLGDVAVWVPDERA
FT                   SGVVPACDLD"
     atgtggatcc gtccggcgat tctcggcgcg caacccagcg gtaggggcgg gtgcgcctcc        60
     gcgacggtcg gggacatgtg cctgttcatc ggaggcaccg atcgatcgcc gcgggcgttc       120
     gacgaggtct ggatcctaaa aatggctccc gaatccaccg acggcgtgtc ctcctccgac       180
     tggcgatgga tcaggaagag caccactgtg cggggcgggg gaacgcttcc cgcgcggacg       240
     ggtgcgaccg ccaccgcggt tgggcgcaag gtgtacgtct tcgggggaca ggaaccttcg       300
     cggggcacgt gcttcaacga cgtcgtggtg ctggactgcg actcgtggga gtggtcgagg       360
     ctcgagatct cgggcccgag cccgcccccg cggaactcgc acgtcgcgtg cgtggtcaac       420
     ggcggcaggt tgctggtggt gtacggcggc tcgtcgccgg aggttggccc catgtcggac       480
     gtctacctgc tggacctgga ggagggcgcg gagcggtgga tccggccgaa ggtgaccggc       540
     caggcacccg agccgaggga gatgcacgcg gcgtgcgtgc tgccaaacac gccgggcgac       600
     ggggactgga acggagacag ggagatcatc gtcgtcggcg gcagaggcgg cgcgtccgtg       660
     ctgagcgatg cggtggttct ggacgcccag aggctcgagt gggtgaggcg cggggatgtc       720
     ggcgtcgcgg tttgcgcgca cacggcggtt ccgtggcggt tgggtcgatc gggcgccgcg       780
     ctcctgtttg gcggtttcgg gggcgccgcg ctcaggggta acgacacggt caccgtggac       840
     ggaaccacgc tcaagacgat cgttaagggg gtatccagcg aggacgtggc gttcgcgccg       900
     gagccgaggt tcgcgcattc gtcgtgtctc gtgccggggg gcgggatgct cgtgttcgcc       960
     ggggtgacgc ccgaggcgga tctcggcgac gtcgccgtgt gggttcccga cgagcgggct      1020
     tccggggtgg tgccggcttg cgatttggat tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page