(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE162

MICSR_1.PE162        Location/Qualifiers
FT   CDS_pept        join(complement(313412..313733),complement(312717..313291))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636502"
FT                   /orf_name="MICPUN_56735"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62105.1"
FT                   /db_xref="UniParc:UPI000199A8A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E139"
FT                   /transl_table=1
FT                   /translation="MGEVTNRATTAAIAVGAAAALGLSYLAHGWYRSRRSPRVLVLVSG
FT                   TLQDGFPLRRNLDAPGAPAEFVGWALVRGVKMYLDPKPRGCREWVDPESGERQRVNPAL
FT                   VCTGDPKDANVYACYAVSEGACLRALLGEPRMLGMTPDTALVDLRAEETSRALASFLAG
FT                   QARRWWENSTPAFGDVAVTERGTLDEGRVAMLTVVAHRVPHGAVPVEPAYVKDDGTRVT
FT                   SFAPCLKRFGGGFELGTRAHELGLEEAIRKWQRRMDPGDGTRGDSLYGAAPETFRMNYA
FT                   VTAGEVARTFSSKRVAA"
     atgggggaag tgacgaaccg cgccacgacc gcggcgatcg ccgtcggggc ggccgccgcc        60
     ctcggcctct cctacctggc gcacggctgg tacagatcgc gccgatcgcc ccgcgttctc       120
     gtgctcgtca gcggcaccct gcaggacggg ttccccctgc gtcgcaacct ggacgcgccg       180
     ggggcgcccg ccgagtttgt ggggtgggcg ctcgtccgag gggtgaagat gtacctcgac       240
     ccgaagccgc gcggatgccg agagtgggtc gacccggaga gcggggagag gcagagggtg       300
     aatccggcgc tcgtgtgcac aggcgacccg aaggacgcca acgtgtacgc gtgctacgcc       360
     gtgtccgagg gcgcgtgcct ccgcgcgctg ctgggcgagc cgaggatgct gggaatgacc       420
     ccggacaccg cgctcgtcga cctccgcgcc gaggaaacct ctcgcgcgct cgcgtcgttc       480
     ctcgcggggc aggcgaggcg gtggtgggaa aattccaccc ccgcattcgg cgacgtcgcg       540
     gtcacggaac gcggaacgct ggacgaaggt cgagtcgcga tgctcacggt ggtggcacac       600
     agggtacccc acggcgccgt cccggtcgag cccgcgtacg tcaaggacga cggcaccagg       660
     gtgacctcct tcgcgccgtg tctgaagcgc ttcggcggcg ggttcgagtt gggaacgagg       720
     gcgcacgagc tcgggctgga ggaggcgatt cggaagtggc agcgaaggat ggacccaggg       780
     gacggaaccc gcggtgactc gctgtacggg gcggcgccgg agacgttcag gatgaactac       840
     gccgtcaccg ccggggaggt ggcgcggact ttctcgtcaa agagggtggc ggcgtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page