(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE166

MICSR_1.PE166        Location/Qualifiers
FT   CDS_pept        318500..320269
FT                   /codon_start=1
FT                   /gene_family="HOG000250646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636506"
FT                   /orf_name="MICPUN_56739"
FT                   /product="Metal dependent hydrolase "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="ACO61672.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG668170"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000199A90B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E143"
FT                   /transl_table=1
FT                   /translation="MDLTLDNSVGKFSPSPAPPAGPPTLLRGALVPNDASEPGTYTRRD
FT                   VLIADGVLKRVAPGGTLSLDVDCPPGTIEEDCSERMLVPGFVNGHTHSVEHWARGLIKP
FT                   LPLEMWVLQLIRHEPRGEEGWAGPESWIKTPAAAIAVSAMHCGVEALLSGTTAIMDHLL
FT                   CRDIKDVEAAVFAYRALGIRAYIAPMLGDDLEPYVNYVPLARDAQGRNGAICGPAGPAP
FT                   GCPDCGGLGAHGSFRTEVGERDPAKTEANLALWREAAQKFHDPKNGINIVVGPVTAYSA
FT                   STELLRGAAEIRKEFGLCGHIHLLETRAQALMARQFLPSGSAVKHLRDTGFLQVPGTTC
FT                   GHCVWLDDEEIAIMAECDATAVHNPFSNLRLGSGVAPLHKYARLGMNVCLGADGACSSD
FT                   GQDMLEVAKLANILPCVATPEYRDWPTAHHTALVLGAANGYKGILLEGKPGQVGKGGVL
FT                   EEGALADLSSWDLTALSMLPRTDPLSLLVQGSRTQAPGAGSALDCAWVNGVRVVQGGSP
FT                   VNVDVKALREVLRAAQGTYRDPAITDPSTHEKTARAETEYRAAMDLDPAGATGLRPAYE
FT                   WPEHCVLYPASQN"
     atggatctca cgcttgacaa ctccgtcggg aagttttctc cctctcccgc gcctcccgcc        60
     gggcccccga ccctgctgcg cggcgcgctc gtccccaacg acgcctccga gcccgggacg       120
     tacacccgtc gcgacgtcct tatcgccgac ggcgtcctga agcgcgtcgc gcccggcggg       180
     accctctcgc tggacgtcga ctgccccccc ggcacgatcg aagaggactg ctcggagcgc       240
     atgctcgtcc cgggcttcgt caacggccac acgcacagcg tcgagcactg ggcgcgcggt       300
     ctcatcaaac ccctgccgct cgagatgtgg gtcctgcagc tgatccgcca cgaaccccgc       360
     ggcgaggagg gctgggccgg accggagtcc tggatcaaga ccccggccgc ggccatcgcc       420
     gtttccgcga tgcactgcgg cgtcgaggcc ctcctctcgg gcaccaccgc catcatggac       480
     cacctcctct gccgcgacat caaagacgtc gaagccgccg tcttcgcgta ccgggccctc       540
     ggcatccgcg cgtacatcgc ccccatgctc ggcgacgacc tcgaacccta cgtcaactac       600
     gtcccactgg cgcgggacgc gcagggaagg aacggcgcca tctgcggccc ggcgggtccc       660
     gccccgggat gccccgactg cggcgggctc ggagcgcacg gctcgtttcg cacggaggtt       720
     ggcgagaggg acccggccaa gacggaggcc aacctggcgc tgtggcgcga ggcggcgcaa       780
     aagtttcacg atcctaaaaa cgggatcaac atcgtcgtcg gacccgtcac cgcgtacagt       840
     gcgagcaccg agctgctccg gggcgcggct gagattcgga aagagtttgg gctgtgcggg       900
     cacattcacc tgctcgagac ccgcgcgcag gcgctgatgg cgcggcagtt ccttcccagc       960
     ggttccgccg tgaagcacct gcgcgacacc ggcttcctcc aggtccccgg caccacctgc      1020
     gggcactgcg tgtggctcga cgacgaggag attgccatca tggccgagtg cgacgccacc      1080
     gccgtgcaca acccgttcag caaccttcgc ctgggcagcg gcgtcgcccc gctccacaag      1140
     tacgcccgac tcgggatgaa cgtgtgcctc ggcgccgacg gcgcgtgctc ctccgacggc      1200
     caggacatgc tcgaggtggc caagctcgcc aacatcttgc cgtgcgtcgc aaccccggag      1260
     taccgcgact ggcccaccgc gcaccacacc gccttggtgc tcggcgccgc gaacgggtac      1320
     aaggggatcc tgctggaggg taagcccggg caggttggta agggcggggt gttggaggag      1380
     ggcgcgctcg cggacctgtc ctcctgggac ctcaccgccc tctccatgct cccccgaacc      1440
     gacccgctga gcctcctggt gcagggcagc cggacgcagg cgccgggggc cggatccgcg      1500
     ctggactgcg cgtgggtcaa cggcgtgcgg gtcgtccagg gcggttcgcc ggtcaacgtc      1560
     gacgtcaaag ccctgcgcga ggtgctgcga gccgcgcagg gtacgtaccg ggatcccgcc      1620
     atcaccgacc cgagcaccca cgagaagacg gcgagagcgg agacggagta cagggcggcg      1680
     atggatctcg acccggcggg tgcgacgggg ctgaggcccg cgtacgagtg gcccgagcac      1740
     tgcgtgttgt acccggcgtc gcaaaattga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page