(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE167

MICSR_1.PE167        Location/Qualifiers
FT   CDS_pept        join(320782..321776,322138..322363)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636507"
FT                   /orf_name="MICPUN_56740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61673.1"
FT                   /db_xref="UniParc:UPI000199A90C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E144"
FT                   /transl_table=1
FT                   /translation="MWTPGHGPELRRARPTCGVDDVDEARFNPLCRRARGVEDDSDPSE
FT                   SDTGFDDDDDDSHSSECDLVENVRQARLNALRRRRDDREEIRRQNETLDRIHRARHAER
FT                   EMAKELSSMRFEAERRHTLAWGDDAEVRDRERAAERAAEAIGDAMDEEELIESTQRGAG
FT                   GDGGVARAAEEAHAWATHDEAWAAFEASVRDGARVRTRDVPWPPGHDRGGDGGGGGTLL
FT                   ASLARCELVERGGGGGAGSCRGGSEDKRLAAFRRAFKRASLRWHPDKFEGKFGGALCDD
FT                   VCGDDDDGMVRTGGTGGTGGEGRGETHAQHIRRRVRCIAQEINDAWSAIVAFAQRRNYL
FT                   ILSLWANVPIDFKARWIAIAVWIEEIGFQFFGLDSREPFAGYFPFTADSLYDGDAGIDP
FT                   HCLSLIA"
     atgtggaccc cgggccacgg gccggagctc cggcgggctc ggccgacgtg cggcgtcgac        60
     gacgtggacg aggcgagatt caatccgctg tgccgacgcg cccgcggcgt ggaagacgac       120
     tcggatccgt ccgaatccga cacgggattc gacgacgacg acgacgacag ccacagtagc       180
     gagtgcgatc tggtggagaa cgtccgccag gcgcgactca acgccctgcg ccggcggcga       240
     gacgaccggg aggagatccg gcgccagaac gaaaccctgg accgcatcca ccgagcgcgt       300
     cacgccgagc gggagatggc gaaggagctc tcgtcgatgc ggttcgaagc cgagcgcagg       360
     cacacgctcg cgtggggaga cgacgccgag gtcagggaca gggagcgcgc cgcggagagg       420
     gccgcggagg ccatcggcga cgccatggac gaggaggaac tcatcgagtc gacacaacgc       480
     ggagccggag gagacggagg agtcgcacgc gccgccgagg aggcccacgc gtgggccacg       540
     cacgacgagg cgtgggcggc gttcgaagcg agcgtccgcg acggcgcgag ggtgaggacg       600
     cgcgacgtgc cgtggccccc gggtcacgat cgcggcggcg acggcggcgg cggtgggact       660
     ctgctggcgt cgctggcgcg atgcgagctc gtcgagagag gagggggcgg gggtgcgggt       720
     tcatgccggg gcgggtccga ggacaagagg ctcgccgcgt tcagacgtgc gttcaagcgc       780
     gcgtcgctgc gatggcaccc ggacaagttc gagggtaagt tcggcggcgc gctctgcgac       840
     gatgtgtgtg gcgacgatga tgacgggatg gtcaggacgg gcgggacggg cgggacgggc       900
     ggggaaggac ggggggagac gcacgcgcag cacatcaggc gcagggtgcg gtgcatcgcg       960
     caggagatca acgatgcgtg gagcgccatc gttgcgtttg cgcagaggcg gaattatctg      1020
     attctatctc tttgggcgaa cgttcccatc gatttcaagg cgcggtggat agcgatcgca      1080
     gtctggattg aagaaattgg atttcaattt ttcgggttag attctcgtga acctttcgcg      1140
     ggatatttcc cattcacagc tgacagcctg tacgatggag acgctggaat tgatccacat      1200
     tgcctgtctc tgatcgcata g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page