(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE169

MICSR_1.PE169        Location/Qualifiers
FT   CDS_pept        325610..329869
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636509"
FT                   /orf_name="MICPUN_56742"
FT                   /product="C2 domain-containing protein "
FT                   /protein_id="ACO61675.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="UniParc:UPI000199A90E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E146"
FT                   /transl_table=1
FT                   /translation="MSGQVVTGTPVFSMSPSNPRSAQVQPGMAPATPPPFNGSSSMSAP
FT                   GYGAGAEGPGASSSPAHTALDVDDQGNRGGDFVTRTWQPARAPDAVALAEVTSQMTSAA
FT                   NVAEVFKATGLGQQDIQSSASRTTEDDGLIVRQRPRARADNIAVRKARAAREARPGDWF
FT                   DPNDGGILCQADPVPPGVERARPARWFDPEAPYLQTVPATDSRIDLEIVDAAGSDRTYR
FT                   FDISVGRLEFSCHPLMSKEDFLAAQLEESFRSYKRREASDLVTLYTAKSAAAAARARAL
FT                   RQEMAAGAALWLAGVSPSDRLIALEEEAEEAQRLAIDEGDRMKASVQHMSELHDAIERE
FT                   RIAYGCRSTSIRFAVRQKGNGESEPVLLAGAARDEGAHVPKPEQQRRAKATSTRFCVAL
FT                   EVNGQQVPGTSRPVTLRSSGGFSTEVAHAFSLSVQRWPDSVRLALYEKGTIVDTFLAVV
FT                   PIAVPGSNPGEPLQDPAPRQYQFSAESPHAPTWRGAQPGASQVQYTSGSLFVTCAWTPN
FT                   AAEAINMGAYGRQHTADVERSVPVAPPPPPSTAAKRAAAAAKVGYADAAGGFGRAVPRP
FT                   APDAVPGGSPSKTSAAALRASLDPLNPEDATLLETLATREALRNAGGGGFRLNLNDETM
FT                   LGVNAKATKRQQLLKLRAEGGVEALPEGGVPLSEGDIPDHLLEQNAEVQSQSKLLSAQL
FT                   PGLAEADKRATRIAEFLAKVKLNVAKGRRDQKMGARASKGVMHTDDVVKDSPLPDITFD
FT                   LTGVFEFFQPRRKLRPARRRAAPPESHPDYCELVVGIQKAFNLPTRAGMQGGAMGGVGG
FT                   GRRSMQRGGGGGGGGYGGGYGDGYGGGAALVASGELNSFVEVSFQGQTLRTRLANGSAP
FT                   SWQESLQLPFRPPGGDFSPAALQGCEDVVTISLFDEATEPAERTYGAGAVAGGTSTTQH
FT                   FLGSIDIPVAALYRGDGGKIEGVLPLDAPPVLLGYSGAGGGGGSGGGRASLPGGGGLAQ
FT                   QPKPSMSVYIQFAPALAKPEPTLSDPGVGEDESVLRHAKVWEKECRAASRHTKQRPYRA
FT                   VATDGMGRSVHLCRYIASAQLPPGFQGAVADEPTLRQLMRFCHLVPHVTDMSAFNLPPG
FT                   VDIWTTSQEFLDMCAGDSEEHALLLCGFLVALGVEAYVVLGVSATDSDAAMVFTPGGQG
FT                   KRPGNPPTYAPMLEDSLIWDPMAGTIFSVYDSACSACLGEIGVVFNSDNVWANVQAHGR
FT                   PHEMNWNLNDTHGWRPFFSAGSFPHRAMPTVQTAITYESYPPAFYERLGAAVEREAMDA
FT                   IVKKRARQHTPFNRRASRALKDLLRDLEGQILISPDDQGGGLNLGGGMRVGSLTELHMS
FT                   QLAGICEGYTVTGCPMNLPFTDAATVRDVIDRLKIADTTRSDVEFAVATHVEPYGCTFV
FT                   CSVWVYVVRLTKISSYQ"
     atgagcggtc aggtggtgac gggaaccccc gtgttctcga tgagcccgag caacccgcgg        60
     tccgcgcagg tgcaacccgg catggctccc gcgaccccgc ccccattcaa cggctcatcg       120
     tcgatgtccg ctccgggtta cggcgccggc gcggagggac ccggcgcgtc gtcgtctccc       180
     gcccacaccg cgctcgacgt ggatgatcaa ggcaaccgcg gcggggactt cgtcacgcgc       240
     acgtggcagc ccgcgagggc gcctgacgcc gtcgccctgg cggaggtcac gtcccagatg       300
     accagcgcgg cgaacgtcgc ggaggtgttc aaggctacgg gtctgggcca gcaggatatc       360
     cagagcagcg ccagccggac gaccgaagac gacggtttga ttgtccgcca acgacccagg       420
     gcgcgcgcgg acaacatcgc cgtgcgcaag gcgcgcgccg cgagggaggc gcgcccgggc       480
     gactggttcg acccgaacga cggagggatc ctgtgccagg ctgacccggt tccccccggc       540
     gtggagcgcg cgaggcccgc caggtggttc gatccggagg ctccgtacct ccagactgtc       600
     ccggcgacgg actcgcgcat cgacctcgag atcgtcgacg ccgccgggtc cgacaggacc       660
     taccgcttcg acatctctgt cggccggctc gagttttctt gccatccgct gatgagcaag       720
     gaagacttcc tcgccgcgca gctcgaggag tccttccgct cctacaagcg cagggaggca       780
     agcgatctcg tcaccctcta caccgcaaag tccgcggcgg cggcggcgag ggcccgagcc       840
     ctgcgccagg agatggccgc gggcgccgcg ctctggctcg ccggcgtgag cccctccgac       900
     aggctcatcg cactggagga ggaagccgag gaggcgcagc ggctcgcgat cgacgagggc       960
     gaccgcatga aggcctccgt gcagcacatg tccgagctcc acgacgccat cgagcgcgag      1020
     cgcatcgcgt acgggtgccg ctccacctcc atccgattcg cggtgagaca aaaaggaaac      1080
     ggcgagtcgg agcccgtgct ccttgcgggc gcggcgaggg acgagggcgc gcacgttccc      1140
     aagcccgagc aacagcgcag ggccaaggcg acgagcacga ggttctgcgt cgcgctggag      1200
     gtgaacgggc agcaagttcc cggcacgtcc cgacccgtca cccttcgatc gtcgggtgga      1260
     ttctccaccg aggttgcgca cgcgttttct ctctccgtgc agcggtggcc ggacagcgtc      1320
     cgactggcgc tgtacgagaa gggcaccatc gtggacacct tcctcgcggt cgtgcccatt      1380
     gccgtgccgg gcagcaaccc gggcgagccc ctccaggacc ccgcgcctcg ccagtaccag      1440
     ttctccgcgg aatctcccca cgcgcccacg tggcggggcg cgcagcctgg cgcgtcgcag      1500
     gtgcagtaca cctcgggctc cctcttcgtc acctgcgcgt ggacccccaa cgcggcggag      1560
     gccatcaaca tgggcgcgta cggcaggcag cacaccgcgg acgtcgagcg atccgtcccc      1620
     gtcgcgcccc cgcccccgcc gtccaccgcc gctaagagag ccgccgccgc cgccaaagtc      1680
     ggttacgccg acgcggcggg cgggttcggc cgagccgtcc cgaggccggc gcccgacgcc      1740
     gtcccgggcg gatctccgtc caagacgagc gcggcggcgt tgcgtgcgag cctggatccg      1800
     ctcaaccccg aggacgcgac gcttctcgag acgctggcga cgcgcgaggc gctgaggaac      1860
     gccggggggg gcgggtttcg ccttaacctc aacgacgaga ccatgctggg agtcaacgcg      1920
     aaggcgacca agcgccagca gcttctcaag cttcgcgccg agggcggcgt cgaggcgttg      1980
     cccgagggcg gcgtgccctt gagcgagggg gacatcccgg accacctcct ggagcagaac      2040
     gccgaggtgc agagccagag caagctgctg tcggcgcagc tcccggggtt ggcagaggcg      2100
     gataagcgcg cgacgcggat tgcggaattt ctcgccaagg ttaagctcaa cgtggccaag      2160
     ggacgcagag atcagaagat gggcgcgagg gcgtccaagg gagtgatgca caccgacgac      2220
     gtggtgaagg actcgcccct tcccgacatc acgtttgacc tcaccggcgt ctttgagttt      2280
     ttccagccga ggcggaaact ccgacccgcg cgccgcagag ccgcgccgcc ggagtcccac      2340
     cccgactact gcgagctcgt cgtcggcatc cagaaggcgt tcaaccttcc cactcgtgcg      2400
     ggcatgcaag ggggcgccat gggcggcgtg ggcggcggga gacggtccat gcagcgcggc      2460
     ggcggcggcg gcggcggcgg ctacggcggc ggctacggcg acgggtacgg gggcggcgcc      2520
     gcgcttgtcg cctcgggtga gctcaactcc ttcgtggagg tgtccttcca gggccagact      2580
     ctgcgcactc gtctcgcgaa cggcagcgcg ccctcgtggc aggagtcgct ccagctcccg      2640
     ttccggcccc ccggcgggga tttctccccc gccgcgctcc aggggtgcga ggacgtggtg      2700
     acgatttcgc tctttgacga agccacggag cccgccgagc gaacctacgg cgccggcgcc      2760
     gtcgccgggg gcacgtccac gacccaacac ttcctgggct ccatcgacat cccggtcgcc      2820
     gcgttgtacc gcggcgacgg gggcaagatc gagggcgtcc tgcccctcga cgcgcccccc      2880
     gtgctgctcg ggtactcggg cgcgggcggc ggcggcggga gcggcggcgg gagagccagc      2940
     ctacccggcg gcggcggcct cgcgcagcag cccaagccgt ccatgtcggt gtacatccag      3000
     ttcgcccccg cgctcgccaa gccggagccc actctgtcgg atccgggcgt gggcgaggac      3060
     gagagcgtgc ttcgccacgc caaggtttgg gagaaggagt gtcgcgcggc gagccggcac      3120
     accaagcagc ggccgtaccg ggcggtggcc accgacggga tgggccgatc ggtgcacctg      3180
     tgcaggtaca tcgcgagcgc gcagctcccg cccgggttcc agggtgccgt cgcggacgag      3240
     ccgacgctcc gtcagctcat gcgattctgc cacctcgtgc cccacgtcac cgacatgtcc      3300
     gcgttcaatc ttccacctgg cgtggacatc tggaccacga gccaggaatt tttggacatg      3360
     tgcgcggggg actcggagga gcacgcgctg ctcctctgcg ggtttctcgt cgcgctcggc      3420
     gtggaggcgt acgtggtcct tggcgtcagc gccacggact cggacgccgc gatggtcttc      3480
     accccgggtg gacagggaaa gaggcccggg aacccgccta cgtacgcgcc catgctcgag      3540
     gattcgctca tctgggaccc gatggcgggg accatcttca gcgtctacga cagcgcgtgc      3600
     agcgcgtgtc tgggcgaaat cggcgtggtg ttcaactcgg acaacgtgtg ggccaacgtc      3660
     caggcgcacg ggcggccgca cgagatgaac tggaacctga acgataccca cgggtggagg      3720
     ccgtttttca gtgcgggttc tttccctcac agggccatgc ccacggtgca gacggccatc      3780
     acgtacgaga gctacccccc cgcgttctac gaacgcctcg gcgcggcggt ggagagggag      3840
     gcgatggacg ccatcgtcaa gaagcgcgcg agacagcaca cgccgttcaa ccgcagggcg      3900
     tctcgcgcgc tcaaggactt actccgcgac ttggagggcc agatcctcat ctcgcccgac      3960
     gaccagggcg gcggtctgaa cctgggaggc ggcatgcgcg tcgggtcact caccgagctg      4020
     cacatgtcac agctcgcggg catctgcgag gggtacaccg tcacggggtg cccgatgaac      4080
     ctcccgttca ccgacgccgc caccgtcagg gacgtcatcg acaggctgaa gatcgcagac      4140
     accaccagga gcgacgtgga gtttgcggtg gcgacgcacg tggaaccgta cggctgcacg      4200
     ttcgtgtgca gcgtgtgggt gtacgtggtg cggctcacga agatttcgag ctatcagtag      4260
//

If you have problems or comments...

PBIL Back to PBIL home page