(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE170

MICSR_1.PE170        Location/Qualifiers
FT   CDS_pept        join(complement(330791..330895),complement(330612..330660),
FT                   complement(329947..330491))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636510"
FT                   /orf_name="MICPUN_56743"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62107.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199A90F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E147"
FT                   /transl_table=1
FT                   /translation="MLCALVMFLGLIIAPTSAYPTGKVVEVTEVDFDAQVAKGPTLVDV
FT                   YADWCGHCRQLAPVWEELAKELEGEVYVVKVNGPKCRSLQQRLHVKAYPSILYLRDGEM
FT                   RSYDAAQRTVQALAAFARKGWRRTKPVPFYMAPNNWYGRSVGWVYKIPAIAREAHGNLR
FT                   KAGWGDVSIIFATLAVPVAAGMFAIFVADVWVVRTTRAQGAAARRRDDARRLLREQQEA
FT                   LERMNRVHAD"
     atgctgtgcg cgctggtgat gttcctgggg ctcatcatcg ccccgacatc ggcctatcca        60
     accgggaagg tggtcgaggt caccgaggtc gacttcgacg cgcaggtagc gaaaggaccg       120
     acgctggtgg acgtctacgc ggactggtgt ggacactgca gacaactcgc gccggtgtgg       180
     gaggaactcg cgaaggagct cgaaggcgaa gtctatgtcg tcaaggtcaa cggcccgaag       240
     tgcaggtccc tgcagcagag gctccacgtc aaggcgtacc cgtccatact ctacctccgc       300
     gacggcgaga tgcgatcgta cgacgcggcg cagaggaccg tccaggcgct cgccgccttc       360
     gccaggaaag ggtggaggcg caccaagccg gtgcccttct acatggcgcc caacaactgg       420
     tacgggcgga gcgtggggtg ggtgtacaag ataccggcga tcgctcgcga ggcgcacgga       480
     aacctgcgaa aggctggttg gggcgacgtg tccatcatct tcgcgacgtt ggccgtgccg       540
     gtggcggcgg ggatgttcgc gatattcgtg gcggacgtgt gggtggtgcg gacgacgcgg       600
     gcgcaggggg cggcggcgag gcggcgggac gacgcgcggc ggctgctgag ggagcagcag       660
     gaggcgctcg aacggatgaa ccgagtgcac gccgactga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page