(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE171

MICSR_1.PE171        Location/Qualifiers
FT   CDS_pept        331059..332345
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636511"
FT                   /orf_name="MICPUN_56744"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61676.1"
FT                   /db_xref="UniParc:UPI000199A910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E148"
FT                   /transl_table=1
FT                   /translation="MPPAGDDYEPTMGAVQLLVHRRLRTVQKRVAKIAKAEEKRSAGGE
FT                   IDDQQKELIDGKPLTMALLEEFTKLSQEVEKAVEEDRLAVLREERAKVAAKAERSAARR
FT                   AAAAGDRPDEATKANEASAAPPVPPVDGGATRTTGKKPGRRGGGRESPADGAAPPAREP
FT                   LASTPNQPPPAEIPQVVDAPAAAKPRRERGGRGKNRRREGDIGDADTRAAPAPGPGAGP
FT                   GGPPGGVFPGHQQGPFQQGPGAPVATVDGVSLRFGSLGVNGPPAGQSRPPDGSVATEEE
FT                   RARRPETVAATLPKPPVPVEMTPAEINLADYGFDDEYGAPDDLVDDNVFHVAPHVAPRF
FT                   DDVGGAPRVDSRARGDRSSAATGGQRPAGTRAAGHSSREKVGGGGERRDAGGRGRGGER
FT                   RDGGGGGGNRGGGRGGRGGRGGRGRPGVE"
     atgccccccg cgggcgatga ctacgagccc accatgggcg cggtccagct cctggtccat        60
     cgcaggctcc gaaccgtcca gaaacgggtc gccaagatcg caaaagccga ggagaagcga       120
     tcggcgggcg gcgagatcga cgaccagcaa aaggagctca tcgacggcaa gcccctgacg       180
     atggcgctgc tcgaggagtt caccaagctg agccaggagg tcgagaaggc ggtggaggag       240
     gatcgtctcg cggtcctgcg cgaggagcgc gccaaggtgg cggccaaggc tgagcgctcc       300
     gcggcgaggc gagccgccgc ggcgggcgat cgccccgacg aggcgacgaa ggctaacgaa       360
     gcctccgccg cgcctcccgt cccacccgtc gacggcgggg cgacgcgaac gacggggaag       420
     aagccgggaa ggagaggagg aggtcgcgag tcacccgcgg acggtgcggc gccgcccgcc       480
     cgcgaacccc tcgcgtcgac ccccaaccaa ccaccacccg ccgagatccc ccaggtggtg       540
     gacgcccccg ccgccgccaa gccgaggcga gagcgcggcg gccgcggcaa gaacagacga       600
     cgcgagggcg acatcggcga cgccgacacc cgggcggcgc ctgccccggg acccggcgcg       660
     ggacccggcg gacccccggg cggtgtcttc ccaggacacc agcaaggtcc tttccagcaa       720
     ggacccggcg cccccgtggc gaccgtcgac ggcgtcagct tgaggttcgg aagcctcggc       780
     gtgaacggcc cacccgcggg ccagtcgagg cccccggacg gatccgtcgc gacggaggag       840
     gagcgggcgc ggcgaccaga gacggtcgcc gcgactttgc caaaaccgcc ggtccccgtc       900
     gagatgaccc ccgccgagat caacctcgcc gactacggct ttgacgacga gtacggcgct       960
     ccggacgacc tcgtggacga caacgtcttc cacgtcgccc cgcacgtcgc cccacgcttt      1020
     gacgacgtcg gcggggcgcc tcgagtcgat tcgcgtgcgc ggggcgatcg gtcgtcggcg      1080
     gcgacgggcg ggcagcggcc ggcgggcact cgagcggccg ggcactcgtc tcgggagaag      1140
     gtcggcggcg gcggcgaacg gagggacgcc ggcgggcgcg ggcgcggcgg cgagaggagg      1200
     gacggcggcg ggggtggcgg gaatcgcggc ggcggaaggg gagggcgcgg cgggcggggt      1260
     gggcgggggc gacccggcgt ggagtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page