(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE173

MICSR_1.PE173        Location/Qualifiers
FT   CDS_pept        333290..334597
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636513"
FT                   /orf_name="MICPUN_56746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61677.1"
FT                   /db_xref="UniParc:UPI000199A912"
FT                   /db_xref="UniProtKB/TrEMBL:C1E150"
FT                   /transl_table=1
FT                   /translation="MRPARAREEGRGGGARPPRGREREDMSRRPGGGGPGGRPGGRRGA
FT                   DGRPPRMPRQGPGGRGGPPIRQRYKKPPGLLSWYKPRVSHGFIAAFSLGILLMLALWTF
FT                   PSYSAYVDRAEMVKQYCLVHGGDNSTGCVKVEIVHESVCDPAVPELYGHLTTDNCTDLC
FT                   VYSDEERTVGNTTAAERLAFVDSFIPGAEVPCFYPPGDSNFTQATFTVPYNPNEQMFLS
FT                   LVWLSPLFFCLLVSVHCALRKPREALELEDDQMLTGLFNEVVIQRNHQEKFVNDVEMRV
FT                   KHLKSAVDGEQQKRLDVVLEVEKERRDRLTSEDNLKHALHENMRSLESKLVREMAQRLA
FT                   SIPIPSKLKEKMMRKADKYREDRDPLLGGRRSKNDRPDSAASLIFEDHQRNAERRRAAL
FT                   ANDLDAQRGAFKQRLEERKSKGKRSKSKDPGAKRRD"
     atgcgtcccg cgcgcgccag ggaggaaggg aggggcgggg gcgcccgccc cccgcgcggg        60
     cgcgagaggg aggacatgtc ccggaggccc ggaggcggcg gccccggcgg ccgccccggg       120
     ggccggcgcg gggcggacgg gcgccctccc cgcatgccca ggcagggccc cggcggtcgc       180
     ggcgggcccc cgatccggca gaggtacaag aagccgccgg ggctcctgag ctggtacaag       240
     cccagggtgt cccacggctt catcgcggcg ttctcgctgg gcatcctgct catgctcgcc       300
     ctgtggacgt tcccgtcgta cagcgcgtac gtcgaccgag cggagatggt gaagcagtac       360
     tgcctcgtcc acggcgggga caactccacc gggtgcgtca aggtggagat cgtccacgag       420
     tccgtgtgcg acccggcggt ccccgagctc tacggtcacc tcaccacgga caactgcacg       480
     gacctgtgcg tgtacagcga cgaggagcga acggtgggga acaccaccgc ggcggagcgt       540
     ttggcgtttg tcgactcgtt catccccgga gccgaggtcc cgtgctttta cccgcccggg       600
     gactccaact tcacccaggc gacgttcacg gtgccgtaca accccaacga gcagatgttc       660
     ctgtccctgg tctggctctc cccgctgttc ttctgtctcc tggtgagcgt tcactgcgcg       720
     ctgcggaaac cgagggaagc gctggagctg gaggatgacc agatgctcac cggattgttc       780
     aacgaggtgg tgatccagcg gaaccaccag gagaagttcg tgaacgacgt ggagatgcgg       840
     gtgaagcacc tcaagtccgc ggtggacggc gagcagcaga agcggctgga cgtggtgctg       900
     gaggttgaga aggagcggcg agacaggctg acgagcgagg ataacctcaa gcacgcgctg       960
     cacgagaaca tgcgcagttt ggagtcgaag ctggtgcggg agatggcgca gcggctggcg      1020
     tcgataccga tcccgtccaa gctgaaggag aagatgatgc gaaaggcgga caagtacagg      1080
     gaggacaggg acccgctgct gggcgggcgg cggagcaaaa acgacagacc cgacagcgcc      1140
     gcgagtctga tattcgagga tcaccagagg aacgcggagc gcaggcgggc ggcgctggcg      1200
     aacgatctgg acgcgcagag gggggcgttc aagcaacggc tggaggagag gaagagcaag      1260
     ggcaagagat caaaatcgaa ggaccccgga gccaaacgga gggactga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page