(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE174

MICSR_1.PE174        Location/Qualifiers
FT   CDS_pept        complement(334707..335657)
FT                   /codon_start=1
FT                   /gene_family="HOG000007498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636514"
FT                   /orf_name="MICPUN_79549"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62109.1"
FT                   /db_xref="HOGENOM:HBG560027"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A913"
FT                   /db_xref="UniProtKB/TrEMBL:C1E151"
FT                   /transl_table=1
FT                   /translation="MGTGSRHSKNAGTMGSENLTYHEKKALGFGTVKERLGKETVKDFD
FT                   ACGLGLQHALDPVVTPEGVLYDREHILQCLLHQKKDIARKMKTWEGEQARDAEKASAEE
FT                   EAKRLAELEKFELENKGGFVNYSASAGTSTATGTSDARIASSADVAATQDDKERMKTMK
FT                   AFWLPSKTPTAERKAEKPDTDTKCPTTLKKLRLKDLLAVKWTKVRKGEEIGGARYMCPV
FT                   TFKTFTNATKIVVLKPSGHAVSEEAWTKVVKDEGTYDGHRVKGVIRLQRGGSGFAGSGT
FT                   QVESKTEFMLGAGSGLADGRGQNRGATSKFGLRFN"
     atgggtaccg gatcccgcca cagcaagaac gccgggacga tgggttccga gaacctcacc        60
     taccacgaga agaaggctct cgggttcggc accgtgaagg agaggctcgg caaggagacc       120
     gtgaaggact tcgacgcgtg cgggctgggt ctgcagcacg ctttggaccc ggtggtgacc       180
     ccggagggtg tcctgtacga ccgcgagcac atcctccagt gcctcctcca ccagaagaag       240
     gacatcgcgc gcaagatgaa gacgtgggag ggggagcagg ccagggacgc ggagaaggcg       300
     tccgccgagg aggaggccaa gaggctcgcg gagctggaga agttcgagct ggaaaacaag       360
     ggcgggtttg tcaactacag cgcatccgcg gggacgtcca ccgcgacggg cacgtccgac       420
     gcgcgcatcg cctcctccgc cgacgtcgcc gcgacgcagg atgacaagga gcgcatgaag       480
     accatgaagg cgttctggct cccgtccaag accccgaccg cggagaggaa ggcggagaag       540
     cccgacaccg acaccaagtg ccccacgacg ctcaagaagt tgcggctcaa ggacctgctg       600
     gcggtgaagt ggaccaaggt tcggaaaggc gaggagattg gcggggcgag gtacatgtgc       660
     ccggtgactt tcaagacgtt caccaacgcg accaagatcg tggtgctcaa gccctcgggt       720
     cacgcggtgt ccgaggaggc gtggaccaag gtggtaaagg acgagggaac gtacgacggg       780
     cacagggtca agggcgtgat caggctgcag aggggcggga gcgggttcgc cgggagcggg       840
     acgcaggtgg agtccaagac ggagttcatg ctcggcgcgg ggagcggact ggcggacggg       900
     cgcgggcaga accgcggcgc cacgtccaag ttcgggcttc gcttcaactg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page