(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE175

MICSR_1.PE175        Location/Qualifiers
FT   CDS_pept        join(336145..336249,336409..338073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636515"
FT                   /orf_name="MICPUN_56748"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61678.1"
FT                   /db_xref="UniParc:UPI000199A914"
FT                   /db_xref="UniProtKB/TrEMBL:C1E152"
FT                   /transl_table=1
FT                   /translation="MSRPGGVSRSRPANEGERDPKRPRIGGAPQNVETEDDDLQVICPP
FT                   VNPVQSEVNAIVAMAVAGGADPVAVEQMLAATLGDPTQVQATLAVLRAVAAGAQNRTTA
FT                   GITAAALSAMNAASGPNGQGNSLAANAVTAVLTRPPHADRPAIIRRCQVDACNKLDVGG
FT                   GKCTAHGGGKRCQVDGCNAGDRGGGKCISHGGGKRCQSDRCDAGAASGGKFCVTHGGGL
FT                   RCTEEGCDRVRKVRGKCAVHGGINKKKLCVVAGCSSKDLGGGLCKTHGGVRLCSHEGCN
FT                   KRAKARGACVQHDSREKICSHPGCAFPARARGKCKDHGGVVMKMCASEGCAAKAATGSD
FT                   RCRAHGGGKRCSHEGCEKMDAGRGFCVAHGGGKRCQVPNCTKGATRSSFCVAHGGGKRC
FT                   TFEGCDKPGHFKGLCAAHGGGKLCQAPDCKKWDAGFGFCRSHGGGKRCSVEGCTTPVKL
FT                   RGLCIKHGGGHTCSVEGCNRSAKTRSLCIEHGGVKLCKVPNCTKMDRGRGFCSKHGNLL
FT                   GLGGLKCTHEGCNKCAVSKGLCCEHGGVRRCQMKGCQKMDRNGGFCNAHQPGGPVPDAL
FT                   PPPGMTQLPGIMA"
     atgtcgcgcc ccggcggcgt atcgagatcg cgacccgcga acgaggggga acgagatccc        60
     aagcgtccca gaatcggagg cgccccgcag aacgtcgaga cggaggatga cgacctgcag       120
     gtgatctgcc ctcccgtcaa cccggttcag tccgaggtca acgccatcgt cgcgatggca       180
     gtcgcggggg gcgcggaccc cgtcgccgtc gagcagatgc tcgcagccac gctcggagat       240
     cccacgcagg tccaggcgac cctcgcagtg ctccgagcgg tcgccgcggg cgcacagaac       300
     agaaccaccg cgggcatcac cgccgcagcc ctctccgcca tgaacgccgc gtcgggaccc       360
     aacggccaag gcaactcact cgccgccaac gcagtcaccg cggtgctcac caggccgccc       420
     cacgccgacc gcccggcgat catccgccgg tgccaggtgg acgcgtgcaa caagctggac       480
     gtcggcggcg gcaagtgcac cgcccacggc gggggcaagc gatgccaggt ggacggatgc       540
     aatgcgggcg accgcggcgg cggcaagtgc atctcgcacg gcggcggtaa gcgatgccag       600
     agcgacaggt gcgacgcggg cgccgcgtcc gggggtaagt tctgcgtgac ccacggcggc       660
     gggctgcgat gcaccgagga gggctgcgac cgcgtgcgca aggtgcgcgg taagtgcgcg       720
     gtccacggcg ggatcaacaa gaagaagctc tgcgtcgtcg cggggtgctc gtccaaagat       780
     ctcggcgggg gattgtgcaa aacgcacggg ggcgtgcggt tgtgctccca cgagggatgc       840
     aacaagcgcg ccaaggcgag gggcgcgtgc gtccagcacg actcccgcga gaagatctgc       900
     tcgcacccgg gttgcgcctt ccccgcgcgc gccaggggta agtgcaagga tcacggcggc       960
     gtcgtcatga agatgtgcgc ctcggagggc tgcgcggcga aggcggcgac gggaagcgat      1020
     cgatgccgcg cgcacggcgg cggcaagcga tgttcccacg agggatgcga gaagatggac      1080
     gccggccgcg ggttctgcgt cgcccacggc ggcggcaagc gatgccaggt gcccaactgc      1140
     accaagggcg ccacccgcag ctccttttgc gtcgcgcacg ggggcggcaa gcgatgcacc      1200
     ttcgaggggt gcgataagcc cggtcacttc aagggcctct gcgcggcgca cggcgggggt      1260
     aagctgtgcc aggctcccga ctgcaagaag tgggacgccg ggttcggctt ttgcaggtcc      1320
     cacggcggcg gcaagcggtg ctccgtggag gggtgcacca ccccggtcaa gctccggggg      1380
     ctctgcatca agcacggcgg cggccacacg tgctccgtcg aggggtgcaa cagatccgcc      1440
     aagacccgct ccttgtgcat cgaacacggc ggcgtgaagc tctgcaaggt gcccaactgc      1500
     actaagatgg accgcggccg cggtttctgc agcaagcacg gcaacctcct cggcctcgga      1560
     ggtttgaagt gcacccacga gggctgcaac aagtgcgcgg tgagcaaggg gctgtgctgc      1620
     gagcacggcg gcgtgaggag gtgccagatg aagggatgcc agaaaatgga ccgcaacggc      1680
     gggttctgca acgctcacca gcctggcggc cccgttcccg acgcccttcc tccccccggc      1740
     atgacccagc tcccgggcat catggcgtga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page