(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE176

MICSR_1.PE176        Location/Qualifiers
FT   CDS_pept        complement(342440..344125)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636516"
FT                   /orf_name="MICPUN_56750"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62110.1"
FT                   /db_xref="HOGENOM:HBG560029"
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniParc:UPI000199A915"
FT                   /db_xref="UniProtKB/TrEMBL:C1E153"
FT                   /transl_table=1
FT                   /translation="MSAAARPAAIAPRDAARRVASTRARRVVSAPLRGRTERRRAPHPA
FT                   RATTRASTPREGRSDDGPTLVETSSGGQQLRRWGRTPTGGFDRQPPRRPEEELAGQGEA
FT                   TSGRSGFARWDPRLSPRLRAVFLPAGYPDTVSPDYAPFIRWHLGSLMFRNVLEVITAQS
FT                   LLVALGMGSTPGALPLTAATKWVLKDGIGSLATLAAGSLGGQKCDEDPKRWWMVSNAFE
FT                   DVARVIELVTPAAPALFLPLAATATFVRTAALTGRGSLVNGSLMQHFARNENTADVRAR
FT                   LEVQGRWLALVALPVGIGIFRTVSQSFASDPEEPARDVAIAVALYGGVVCAHLVCIWNA
FT                   AKVLRFETLNRARLVRQARAFRDGGAAAIADYNAAGDEEGVFRARFSPGDPVLGASLPD
FT                   AARDWAHLERLVGHARDGFISPMELPPGSSGRTDVGRRFALGWNERDGGCPAVLLDADA
FT                   TARDVFAAALAGVHASRGVRGGDDAEGFGRAYAWGDARVDEFIVAMAAKGWRVDFVQLG
FT                   TAPRYRLGSLLGTGSGGGEVGGGTRGGKGGSVGVDASVDDVLAT"
     atgagcgcag cggcgcggcc ggccgcgatc gcgcctcgcg acgcggcgcg acgcgtcgcg        60
     tcgacgcggg cgcgacgcgt cgtctcggca ccgcttcgag gacggacaga gaggaggagg       120
     gcgccgcatc ccgcgcgcgc gacgacccgt gcgtcgacac cgagagaggg gcgatctgac       180
     gacggtccga cgctcgtgga gactagcagc ggcgggcagc agctgcgcag gtggggtcgc       240
     accccgaccg gcggcttcga tcgccagccc ccgcggcgac cggaggagga actcgctgga       300
     cagggcgaag cgacgtcggg gcgctccggt ttcgcgaggt gggacccgag gctgtccccg       360
     aggctccgcg ccgtcttcct gcccgcgggc taccccgaca ccgtctcgcc ggactacgct       420
     ccgttcatcc ggtggcacct cggctcgctc atgttccgca acgtcctcga ggtcatcacc       480
     gcgcagagcc tattggtggc gctcgggatg ggctccacgc ccggcgcgct cccgctcacg       540
     gcggcgacga agtgggtcct caaggacggc atcggttccc tcgcgacgct cgcggcggga       600
     tccctcggcg ggcagaagtg cgacgaggat cccaagcggt ggtggatggt gagcaacgcg       660
     ttcgaggacg tcgcgcgggt catcgagctc gtcacccccg cggcgcccgc gctcttcctc       720
     ccgctagccg cgacggccac gttcgtgcgc accgcggcgc tcacggggcg gggatcgctc       780
     gtgaacgggt ccctcatgca gcacttcgcg cgcaatgaga acaccgcgga cgtccgcgcc       840
     aggctggagg tccaggggcg gtggctcgcc ctcgtcgcgc tcccggtggg catcggcatc       900
     tttcgcacgg tttcgcaatc cttcgcgagc gatccggagg aacccgcgag ggacgtcgcc       960
     atcgcggtgg cgctctacgg cggcgtcgtg tgcgcgcacc tggtgtgcat atggaacgcc      1020
     gcgaaggttc tgcggttcga gacgctcaac cgcgcgaggc tggtgcgcca ggcgagggct      1080
     tttcgcgacg ggggagccgc ggccatcgcc gattacaacg cggctggcga cgaggaaggg      1140
     gtgtttcgcg cgaggttttc gcccggcgat cccgtcctcg gggcgtccct cccggacgcg      1200
     gcgagggact gggcgcacct cgagcgtctc gtagggcacg cgcgggatgg atttatttcc      1260
     ccgatggaac ttcctcccgg gtcttcgggt cggacagacg tcggacgaag gttcgcgctg      1320
     gggtggaacg agagggacgg cggttgtcca gcggtgctcc tcgacgccga cgcgactgcc      1380
     cgcgacgtct tcgccgcggc gctcgctggg gtgcacgcga gtcgtggggt tcggggcggg      1440
     gacgacgcgg agggttttgg gcgggcgtac gcgtgggggg acgcgagggt ggacgagttt      1500
     atagtggcga tggctgcgaa agggtggcgc gtggatttcg tgcagctggg tacggcgccg      1560
     aggtacaggc tcgggtctct gctcggtaca ggatcgggag gcggggaagt ggggggcggg      1620
     acgcgcgggg ggaagggggg aagcgtcggg gtggacgcgt cggttgacga cgtcctcgcg      1680
     acgtga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page