(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE177

MICSR_1.PE177        Location/Qualifiers
FT   CDS_pept        344602..345435
FT                   /codon_start=1
FT                   /gene_family="HOG000200395" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636517"
FT                   /orf_name="MICPUN_56751"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61679.1"
FT                   /db_xref="HOGENOM:HBG560030"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199A97D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E154"
FT                   /transl_table=1
FT                   /translation="MREARDAEGPRRSFSLHRVSEHDRLVGEGRDVRILHVVRHAQGTH
FT                   NVDQKYRDPRNHDARLTGFGEQQCEALSRTPAAIEAQRSASLVVTSPLTRCVQTALLSF
FT                   PDIARREEVPFVALECIRETVNFACDGRRRRSEIAADFPRVNFSADDGVGDEDELWARY
FT                   ENLCGPTSAHDGHRESCDLPSVADRGRAFFAWLRRRPEREAIVSSHSAFLRCVFSWGQD
FT                   GGVRAAPDQALGESVWGELVDVNVPVVDYRGDVKLEYDLRRDWENCEMRTFLVAF"
     atgagagagg ctcgagacgc cgaggggccg cgccgatcct tctccctgca ccgcgtgtcc        60
     gagcacgatc gactggtggg ggaggggagg gacgtgcgga tactgcacgt cgtgcggcac       120
     gcgcagggca cgcacaacgt cgatcaaaag taccgcgacc cgcggaacca cgacgcgagg       180
     ctcaccgggt tcggggagca gcagtgcgag gccctgtcgc gaacgcccgc cgcgatcgag       240
     gcgcagcgat cggcatcgct cgtggtcacc tccccgctca cacgctgcgt ccagaccgcc       300
     ctgctgtcgt tcccggacat cgcacgaagg gaggaggtac ccttcgtcgc tctcgagtgc       360
     attcgcgaga cggtaaattt cgcctgcgac ggtcgaaggc gccggtcgga gatcgcggca       420
     gacttcccgc gggtgaactt ctccgccgac gacggcgtcg gggacgagga cgagctgtgg       480
     gcgaggtacg agaacctgtg cgggcccacg agcgcgcacg acggtcacag ggagagctgc       540
     gacctgccct cggtggcgga ccgcggcaga gcgttcttcg cgtggcttcg acgtaggccc       600
     gaacgggagg cgatcgtcag ctcgcacagc gcgttcctcc ggtgcgtgtt cagctggggc       660
     caggacggcg gggtgcgggc ggcgcccgat caggcgctgg gagaatcggt gtggggggaa       720
     ctcgtcgacg tgaacgtccc agtggtggac taccgcggcg acgtcaagtt ggagtacgac       780
     ttgcggaggg attgggaaaa ctgcgagatg cgaaccttcc tcgtggcgtt ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page