(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE178

MICSR_1.PE178        Location/Qualifiers
FT   CDS_pept        complement(345588..346661)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636518"
FT                   /orf_name="MICPUN_56752"
FT                   /product="Predicted protein"
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ACO62111.1"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG735778"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="UniParc:UPI000199A97E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E155"
FT                   /transl_table=1
FT                   /translation="MSFAAVSTHAGAVASSRRAPVGMGASTLGEQRQVGRLVDHVAGRR
FT                   YRHRRFDVRWTASAGDPNNESRRRSLNSRNAPGHAHRRGPKPPSIDRVLRAMPELTPES
FT                   PKDKPVSTNAMSFDESSIGDTEFIAETKLPTGSGFYRLRGYRHSVDGGVPSEPVAICFG
FT                   DIEGREKVPVRVHDACFTSEVLGSLKCDCKQQLQLAMEYIQENDGMVIYLHQEGRGIGL
FT                   ANKIAAYALQDTQGLDTVDANRALGLPDDVREYTAVANILEDMGIRSIQLMTNNPRKVA
FT                   TLERLGVKIEGRIPCIVKANLFNQGYLEAKEGRMKHFLDGSWCYWDHSGNTFDEDDAAA
FT                   SGEGGGAEQGEPAAEEK"
     atgagtttcg ccgcggtttc aacgcacgcg ggagcggtcg cgtcctcgcg acgcgcgccc        60
     gtcgggatgg gagcctccac gctcggagag caacgacagg ttggccggct ggtcgatcac       120
     gtcgcgggac ggcgataccg ccaccgtcgc ttcgacgtga ggtggacggc gagcgcgggg       180
     gatccgaaca acgagtcgcg ccgcagatcg ttgaactcgc gcaacgcccc gggtcacgcg       240
     caccgccgcg gcccgaagcc gccgtcgatc gatcgcgtcc tccgcgcgat gcccgagctc       300
     acgccggagt cccccaagga caagccggtg tccaccaacg ccatgtcctt cgacgagtcc       360
     tcgatcggcg ataccgagtt catcgccgag accaagctcc ccaccggcag cggcttttac       420
     aggcttcgcg ggtaccgaca ctccgtcgac ggcggcgttc cgtcggagcc cgtcgccatc       480
     tgcttcggcg acatcgaggg ccgcgagaag gtgccggtgc gagtccatga cgcgtgcttc       540
     acctccgagg tgctcgggtc cctcaagtgc gactgcaagc agcagctgca gctcgccatg       600
     gagtacatcc aggagaacga cggcatggtc atctacctcc accaggaggg ccggggcatc       660
     ggcctcgcca acaagattgc cgcgtacgca ctgcaggaca cccagggatt ggacaccgtg       720
     gacgccaacc gcgccctggg cttaccggac gacgtgaggg agtacaccgc ggtggcgaac       780
     atcctcgagg acatggggat caggtcgatc cagctgatga cgaacaaccc gaggaaagtc       840
     gccacgctgg agcggctcgg ggtgaagatc gaaggacgga tcccgtgcat cgtcaaggct       900
     aacctgttca accaggggta cctcgaggcg aaggagggac ggatgaagca cttcctggac       960
     gggagctggt gctactggga ccactcgggg aacaccttcg acgaggacga cgcggccgcg      1020
     agcggcgaag gcggcggcgc ggagcagggt gaacccgccg cggaggagaa gtaa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page