(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE179

MICSR_1.PE179        Location/Qualifiers
FT   CDS_pept        357736..359223
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636519"
FT                   /orf_name="MICPUN_107881"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61680.1"
FT                   /db_xref="UniParc:UPI000199A97F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E156"
FT                   /transl_table=1
FT                   /translation="MAVTSTFGVTSDFTVNTDKFIVNATNGNTKMTGNLEMSGDTATLT
FT                   HSGSTGGLAISSAQHVDVESVRFTTNQIGSTGDPDLITLTDNKVSISGQTLEMSGSTSR
FT                   LQHTGTTSLAISSTNGHITIAGGSGDYVDVESVRFTDDYIGISGDTDIIRLTSTGSQAT
FT                   VAMVADVDVTGTMDVSSDFAVNTNSFKVTGTNGNTEILGSLTMKAVSGIITHDGASGSL
FT                   AISSSTGPVTIAGQSTGGYVDVESVRFTDNQIGINGDADIITLTSLSGTSTVAFANKIT
FT                   TGDLATLNSATVTTTLHSGGDLTVGTGPKLTVAASSGDVVTAGKIAVAGSHGDATKALY
FT                   VTGSVYATGAVTSASDSRFKRDVRSIHDPLAIVRSLEPVTFTFKRDAFPTRDFPVETQA
FT                   GFLAQDLERVLPHLVTEDDEGYKGVAYERLGVYAVAGVKALDESMERLDESMERLDESM
FT                   ERLQNDTVARLEARVVELERALAALVSRASGPTPAGR"
     atggctgtga cgagcacgtt tggcgtgacc tcggacttca cggttaacac tgacaagttc        60
     atcgtcaacg cgactaacgg aaacacgaag atgacgggga atcttgagat gtcaggagac       120
     acggcgacgc tgacacacag cgggtcgacg gggggtctcg cgatatcgag cgcgcagcac       180
     gtggacgtgg agtcagtgcg gttcacgaca aaccagattg gcagcacggg agaccctgac       240
     ttgatcacct tgacagacaa caaggtgagt atatcgggac agacgctaga gatgtccgga       300
     agtacttctc gactgcagca cacggggacg acgagcctgg cgatctcgag caccaacggg       360
     cacatcacga ttgctggggg gtcaggtgac tacgtggatg tggagtcggt gaggttcaca       420
     gatgactaca tcggcatcag tggcgacacc gacatcatcc ggctgacgag caccgggagc       480
     caggcgaccg tggcgatggt ggcagatgtg gacgtgacgg gtacgatgga cgtgagctcg       540
     gactttgcgg tgaacaccaa cagcttcaag gtgaccggga ccaacggcaa cacggagatc       600
     ctgggaagcc tgacgatgaa ggctgtgagc ggcatcatca cccacgacgg ggcatcaggg       660
     agcctggcga tctcgagcag cacggggcct gtgacaatcg cggggcagtc gactgggggt       720
     tacgtggacg tggagtcagt gcggttcacc gacaaccaga ttggcatcaa cggcgacgcc       780
     gacatcatca ccctgacgag cctcagcggc accagcacgg tcgcgttcgc gaataagatc       840
     acgacgggcg acctagcgac gcttaactcc gccacggtca cgacaaccct ccactcgggc       900
     ggcgatctca ccgtcggaac cggccccaag ctcaccgtcg ccgcctccag cggggacgtc       960
     gtcaccgccg ggaagatcgc cgtcgccgga tcacacgggg acgccaccaa ggcgctctac      1020
     gtgaccggat ccgtgtacgc caccggagcc gtcacgtccg cgtccgactc gaggttcaag      1080
     cgggacgtgc gatccattca cgacccactc gccatcgttc gctccctcga gcccgtgacg      1140
     tttacgttta agagggacgc gttcccgacg agggacttcc cggtggagac gcaggcgggc      1200
     ttcctcgcgc aggacctcga gcgtgtcctg ccccacctgg tcaccgagga cgacgagggg      1260
     tacaaggggg tggcgtacga gcggctcggg gtgtacgccg tggccggggt gaaggcgctt      1320
     gacgagtcga tggagcgact tgacgagtcg atggagcgac ttgacgagtc gatggagcga      1380
     cttcaaaacg acacggtggc gaggttggag gcgagggtgg tcgagctgga gcgggccctc      1440
     gcggcgctcg tctcgagagc ctcggggccg acgccggcgg ggcgatga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page