(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE18

MICSR_1.PE18         Location/Qualifiers
FT   CDS_pept        join(33700..33732,33805..35230,35262..35266)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636023"
FT                   /orf_name="MICPUN_56589"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61593.1"
FT                   /db_xref="UniParc:UPI000199AAB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P5"
FT                   /transl_table=1
FT                   /translation="MTELAVDRSLLVPTRGESSTQDENFGGYRLARDLLIEDRTEAHVL
FT                   ETPAMDSSAAMGKTLGRIAHLAASRRNQLFDLGIQRPDPGHDDCFAFASEGGVFHAVDV
FT                   PRNIDEPIKVSPINSIPIVATEDPAEGPRMGPSIARAANSNTFALSTGGGDLSVTSEGG
FT                   AVRGCEPPTFGEDGGRRPFVIESVTHRPGSMALLVWAVSTGAGAAVELFRLTVEESPDS
FT                   KAWTPTGAAVKVAEGTSPPLWCKVATSSSVDEVFVVAMETVEGRSVKAKSGEPVQEWLP
FT                   QDDEEAEEWIGNPGSAMVPSDGRGMAAWKAFNAEGDSEDEDDDAPRNPFDADLEDGPLH
FT                   VLMVSAWSDEVKTTARMPRNKPCAIVHGGAHIGVSHGVHCLTVSVEADGSARHVSTNQA
FT                   LSYVAKGKPNRKFVLATPDGTCAAVVETKRSSFVYRTPAPAPNPPKSGLHQIFDLTEKV
FT                   GSKLRGLPAGGVARQNSAEAPVLGARLVC"
     atgacagagc tcgcagttga tcgttcgctt ttggtgccta ctcgtgggga atcttcgacg        60
     caggacgaga acttcggcgg gtaccgtctg gcgagggacc tcctcatcga ggaccggacc       120
     gaggcgcacg tcctagaaac accagcgatg gactcgtcag cggcgatggg caagactctt       180
     ggacgcatcg cacacctggc cgcttcgaga cgtaaccagc tcttcgacct cggaattcag       240
     cgccccgatc ccgggcacga cgactgcttc gccttcgcat ccgaaggcgg agtattccac       300
     gccgtggacg taccccgcaa catcgacgag cccatcaagg tcagtcccat caactcgatt       360
     cccatcgtcg ccacggagga tcccgcggaa ggtccacgca tgggcccgtc catcgcgcgg       420
     gcggcgaact cgaacacgtt cgccttgtcc acgggcggcg gcgacctgtc cgtgacgtcg       480
     gagggtggcg cggtgcgcgg gtgcgagccg ccgacgttcg gtgaggatgg cgggcgtaga       540
     ccgttcgtca tcgagtcggt cacgcatagg ccgggatcga tggcacttct cgtgtgggcc       600
     gtatcaaccg gcgcgggggc cgcggtggag ctctttcgcc tgaccgtcga ggaaagtcca       660
     gactcgaaag catggactcc gacgggggcc gctgtgaaag tggctgaggg aacgtcgccg       720
     cctctgtggt gtaaggtggc gacatcatcg tcggtcgacg aggtttttgt ggtcgccatg       780
     gagacggtcg aggggaggag cgtgaaagcc aaaagcggtg agcccgtgca ggagtggttg       840
     ccgcaggatg acgaagaagc ggaggagtgg ataggcaacc ctggatccgc aatggtgcca       900
     agtgatggga ggggtatggc agcgtggaag gcgttcaacg ccgagggcga cagcgaagac       960
     gaggatgacg acgcgccgcg aaacccgttt gacgcagacc tagaggacgg acctctccat      1020
     gtgttgatgg tgtcagcctg gtccgacgag gtaaagacga ccgcacgcat gcccaggaac      1080
     aaaccatgcg ccatcgtgca cggcggagca catatcggtg tgagtcacgg ggtgcactgc      1140
     ctgaccgtgt cggtcgaagc ggacgggtcg gcgaggcatg tctccaccaa ccaggcgctc      1200
     tcttacgtcg ccaagggcaa acccaacagg aagttcgtct tggccacccc tgacggaacc      1260
     tgcgcggcgg tggtggagac taagcgatcc agcttcgtgt acaggacccc cgcgccggcg      1320
     ccgaatcctc ccaagagcgg tctgcatcag atattcgacc tcacggagaa ggttggatcg      1380
     aagcttcggg gtctccccgc ggggggtgtc gcccgccaaa attccgccga ggcgcccgtg      1440
     ctcggtgcca ggctggtttg ctag                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page