(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE181

MICSR_1.PE181        Location/Qualifiers
FT   CDS_pept        complement(360631..361968)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636521"
FT                   /orf_name="MICPUN_56754"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62112.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A981"
FT                   /db_xref="UniProtKB/TrEMBL:C1E158"
FT                   /transl_table=1
FT                   /translation="MGVDPGDLLSLVPRDVLVKHMFADFAPIELLICSRVCHSWRTVFI
FT                   ESGLLPLPDRCELLDSIQVLVRSVSLLKWARSNARSWMEGERLQQIMILAAAEGRLDTL
FT                   RWLSSEGYRIHSKCLSDLVFAAASGAHQETLEWLWVVDNMRSLAIPESFKGTPEFNSDE
FT                   YDEYDECISLDHWRDIWFIVAVQGSGSSGNIEFAVWVRNFAASVGHTIDLHLEEDCLVR
FT                   AIHEKHVHFIKWRRGMFEKFNDQTRRTLCWEAAREGSVEILTFLLEECRWNTVFDDYGD
FT                   LYRAAIFYNPDVDHQPILSYLYEKGHGFDSRATVAAAFVGNLDTLEWLRARGCPWNSNV
FT                   VENAAEKGHLHILEYALDHGCDGGAWVFCYAARGGHIQVMEWAMARGLEWDERTCFSAA
FT                   KRGHLDALKWLRARGCPWDRWTRVYAERGRHTELLQWAIDNGAPPP"
     atgggagtgg accccggtga cctcctgtcg ttggtgcctc gcgatgtcct cgtgaaacac        60
     atgttcgcag actttgcccc gattgagcta ttgatatgct cccgcgtctg ccattcgtgg       120
     cggaccgtgt tcatcgagag cgggctgttg ccattgccgg accgctgcga actcctcgac       180
     agcatacaag tactggtccg ctcagtctcc ctcctgaagt gggcccgaag caacgctcgg       240
     tcgtggatgg aaggcgaacg gctccagcaa ataatgatac tcgccgcagc tgaaggccgg       300
     ctggacaccc tcagatggtt aagctcggaa ggctatagga tccacagtaa atgtctttct       360
     gaccttgtct tcgccgcagc ctcgggtgcg caccaagaaa cgcttgagtg gctctgggtc       420
     gtggacaaca tgagatccct ggccattccg gaaagcttca aagggacgcc cgagttcaat       480
     tcggatgagt acgatgagta cgatgagtgc atctcacttg accactggcg tgatatatgg       540
     tttatcgttg cagtgcaggg gagtgggagt tcagggaaca ttgagtttgc ggtgtgggtg       600
     cgcaatttcg cagccagtgt cggtcacaca atagatctgc accttgagga ggattgtctt       660
     gtgcgcgcca tccatgagaa acacgtgcat ttcatcaaat ggcggcgcgg gatgtttgag       720
     aagttcaatg atcaaacacg acgaactttg tgttgggaag ccgctcggga aggcagcgtt       780
     gagatcttga cattcctgct cgaagagtgc cgctggaaca cagtgtttga tgactacggt       840
     gatctatatc gtgcggccat cttttacaac cctgacgtcg accaccaacc gatcctctcc       900
     tacctttacg agaaaggaca cgggttcgac tcgagggcca ccgtcgcggc tgcattcgtg       960
     ggtaacttgg acacgctcga gtggctcaga gcgaggggat gcccgtggaa ctcgaacgtc      1020
     gtggagaatg ccgccgagaa gggacacttg cacattctcg agtacgcgct cgaccacggg      1080
     tgcgacggag gagcgtgggt cttctgctac gcggcccgcg gcggacatat ccaggtgatg      1140
     gagtgggcta tggcgagggg actcgaatgg gacgagagga cctgcttctc ggccgcgaaa      1200
     cgcggacatc tcgacgcgct caagtggctc cgagcgagag gatgtccgtg ggatcgatgg      1260
     accagggtct acgccgagag gggccgtcac accgagctgc tgcagtgggc catcgacaac      1320
     ggagcgccgc cgccgtga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page