(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE182

MICSR_1.PE182        Location/Qualifiers
FT   CDS_pept        362071..363294
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636522"
FT                   /orf_name="MICPUN_99342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61682.1"
FT                   /db_xref="UniParc:UPI000199A982"
FT                   /db_xref="UniProtKB/TrEMBL:C1E159"
FT                   /transl_table=1
FT                   /translation="MRRLHVQRLLLCCALLLLPNARALWFSMPPECDGRCWEEDVKHPL
FT                   ASCDLEVVEGAITPEEADDVVAAAEAHAAVHGWHSQRHIAYPTRDLPWTALPSVARVFD
FT                   KLWGAMEESVRRRCGVRPIDRLTPNDIFVVKYTPEGQAGLDRHRDASSFSFNAALSDPT
FT                   SYGGGGTRVWLDSAVRTLREKYLRAELEGVVRDGTAPGASAEARGAAARAEATLDRPPG
FT                   TLDVDGYVVRPDRLLPEDGETRKIAKGSVMVHGGRNVHEGTAIVSGTRHIVAGFVGLNR
FT                   HCCTLRYSGWRGVMALVRVTAMNNSARGGVRDKVGGRVPLWDYVLYEEWRGVFRWIRGA
FT                   SLVLALLSLAAYAAWHVATRLSPRFNLAARRALAVVAGYESSFFRGLARKRRRAMRSAL
FT                   PTKHSLDD"
     atgcggcgtc tccatgtcca gcggctcctc ctatgctgcg cgctgttact gcttcctaac        60
     gcgcgcgcgc tttggttctc aatgcccccc gagtgcgacg ggcggtgctg ggaggaagac       120
     gttaagcatc ccctcgcgtc ctgcgacctg gaggttgtcg agggcgcgat aacgccggag       180
     gaggcggacg atgtcgtggc cgccgcggag gcgcacgcgg cggtgcacgg atggcatagc       240
     cagcgtcaca tagcgtatcc cacccgggac ctaccctgga ccgcgctgcc gagcgtcgcg       300
     cgcgtcttcg acaagctctg gggcgcgatg gaggagagcg tgcgtcggcg gtgcggcgtc       360
     aggcccatcg acaggctcac cccgaacgat atattcgtgg tgaagtacac cccggaggga       420
     caggcggggc tcgacaggca cagggacgcc agcagcttca gcttcaacgc ggcgctctcc       480
     gacccgacgt cgtacggcgg gggcggcacg cgcgtctggc tggactcggc ggtgagaacc       540
     cttcgcgaga agtacctccg ggcggagttg gagggagtcg ttcgcgacgg gaccgcgccc       600
     ggggcgtccg cggaagcgcg gggggccgcg gcgcgcgccg aggcaacgct ggatcgcccg       660
     cccggcaccc tcgacgtcga cgggtacgtc gtcaggccgg acaggctcct accggaggac       720
     ggcgagacgc gcaaaatcgc caaaggctcc gtcatggtcc acggcggtcg caacgtccac       780
     gagggaacgg cgatcgtctc cgggacccga cacatcgtcg ccgggttcgt gggtctcaac       840
     aggcactgct gtacgctgag gtacagcggg tggcgcgggg tgatggcgct ggtcagggtg       900
     acggcgatga acaacagcgc gagggggggc gtgagggaca aagtcggcgg ccgcgtgccc       960
     ctctgggact acgtcttata cgaggagtgg cggggggtgt tccggtggat ccgcggggcg      1020
     tcgttggtac tcgcgctgct gtcgctcgcc gcgtacgccg cgtggcacgt cgcgacgcgt      1080
     ctctcgccgc ggttcaacct cgcggcgcgg cgggcgttgg cggtcgtcgc cggatacgaa      1140
     tcgtcctttt ttcgcggctt ggccagaaaa aggagacgag cgatgcggtc ggcgctcccg      1200
     acgaagcact cgctggacga ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page