(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE183

MICSR_1.PE183        Location/Qualifiers
FT   CDS_pept        complement(363422..364594)
FT                   /codon_start=1
FT                   /gene_family="HOG000012606" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636523"
FT                   /orf_name="MICPUN_56756"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62113.1"
FT                   /db_xref="HOGENOM:HBG407194"
FT                   /db_xref="UniParc:UPI000199A983"
FT                   /db_xref="UniProtKB/TrEMBL:C1E160"
FT                   /transl_table=1
FT                   /translation="MASALVTARSTAPAVLAGALSRPPPRRVDRLPRSVSPRTAAARPR
FT                   EAPSRRRLAAAEEDGTATTATTSEGDDEEEIPQIEIPERPEHVRVVDAFLPAADAVALR
FT                   GVFDAHNDDPRRVHEYRFVWDYWHVPGQYTQLRTPAADYFPKEQFEQLEDALLTYAKET
FT                   LGCSAMTPVWLSNYVDGMRQEIHADVPHGPFAFVLSLTNWDKRRFTGGETFLLRPETLD
FT                   YWRGFETSSVVERGAVVQTVEPEFNRLTVFDPRIPHGVNVVEGTRDVREGRLVLHGWFR
FT                   DLAPHFSGALTEAACEPALGEILPRLYEALGALPRARGVVVIRVNVDANGAVTGTEWKA
FT                   DTLVPAPAPNLPDPTEVRDAILLEIAGTFMDAEFPAAGAPGAVTMPFEFD"
     atggcatccg ccttggtgac cgcgcgctcg accgcgccgg ccgtcctcgc gggcgcgctt        60
     tcgcgacccc cgccgcgccg cgtcgaccgc ctcccgcgct cggtctcgcc ccgaaccgcc       120
     gccgctcgcc cgagagaggc gccctctcga cgacgcctcg ccgccgcgga ggaggacggc       180
     acggcgacga cggcgacgac gagcgagggc gacgacgagg aggaaatccc gcaaatcgag       240
     atccccgagc ggcccgagca cgtccgcgtc gtcgacgcct ttctccccgc cgccgacgcc       300
     gtcgcccttc gcggcgtgtt cgatgcgcac aacgacgacc cgagacgagt gcacgagtac       360
     aggttcgtgt gggactactg gcacgtcccc gggcagtaca cccagctcag gacccccgcg       420
     gcggattatt tccccaagga gcagttcgag cagttggagg atgcgctgct gacgtacgcg       480
     aaagagacgc tggggtgctc ggcgatgacg ccggtgtggc tgtcgaatta cgtcgacggg       540
     atgcgtcagg agatccacgc ggacgttccc cacggaccct tcgccttcgt gctgtcgctc       600
     acgaactggg acaaacgacg gttcacgggc ggggagacgt ttcttctgcg acccgaaacg       660
     ctggactact ggcgagggtt cgagacgtcc tcggtggtgg agcgcggcgc cgtcgtccaa       720
     accgtggagc ccgagtttaa ccgtctgacg gtgtttgacc cgaggatacc gcacggcgtc       780
     aacgtcgtgg agggcacgcg ggacgttcgg gaggggcggt tggtgctgca cgggtggttc       840
     agggacctcg cgccgcactt ctccggcgcg ctgaccgagg cggcgtgcga gccggcgctg       900
     ggcgagatac tgccccggct gtacgaggct ttgggagcgc tgccgagggc gcgcggggtg       960
     gtcgtcatcc gggtgaacgt cgacgcgaac ggagcggtga ccgggacgga gtggaaggcg      1020
     gacacgctgg ttcccgcgcc ggcgccgaac ctcccggacc cgacggaggt cagggacgcg      1080
     atcctgctgg agattgcggg gacgttcatg gacgccgagt ttcccgcggc gggggcgccg      1140
     ggcgccgtca cgatgccgtt cgagtttgac tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page